Showing Protein Sulfotransferase 1C3 (HMDBP11965)
Identification | ||||||||
---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11965 | |||||||
Secondary Accession Numbers | None | |||||||
Name | Sulfotransferase 1C3 | |||||||
Synonyms |
|
|||||||
Gene Name | SULT1C3 | |||||||
Protein Type | Unknown | |||||||
Biological Properties | ||||||||
General Function | Not Available | |||||||
Specific Function | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor and has low sulphotransferase activity towards various substrates with alcohol groups (in vitro). May catalyze the sulfate conjugation of xenobiotic compounds and endogenous substrates. | |||||||
Pathways | Not Available | |||||||
Reactions |
|
|||||||
GO Classification |
|
|||||||
Cellular Location | Not Available | |||||||
Gene Properties | ||||||||
Chromosome Location | 2 | |||||||
Locus | 2q12.3 | |||||||
SNPs | Not Available | |||||||
Gene Sequence | Not Available | |||||||
Protein Properties | ||||||||
Number of Residues | Not Available | |||||||
Molecular Weight | 35888.345 | |||||||
Theoretical pI | 6.911 | |||||||
Pfam Domain Function | Not Available | |||||||
Signals | Not Available | |||||||
Transmembrane Regions | Not Available | |||||||
Protein Sequence |
>>gi|56847626|ref|NP_001008743.1| sulfotransferase 1C3 [Homo sapiens] MAKIEKNAPTMEKKPELFNIMEVDGVPTLILSKEWWEKVCNFQAKPDDLILATYPKSGTT WMHEILDMIL |
|||||||
External Links | ||||||||
GenBank ID Protein | Not Available | |||||||
UniProtKB/Swiss-Prot ID | Q6IMI6 | |||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||
PDB IDs | ||||||||
GenBank Gene ID | Not Available | |||||||
GeneCard ID | Not Available | |||||||
GenAtlas ID | Not Available | |||||||
HGNC ID | HGNC:33543 | |||||||
References | ||||||||
General References | Not Available |