Hmdb loader
Identification
HMDB Protein ID HMDBP11968
Secondary Accession Numbers None
Name Sugar transporter SWEET1
Synonyms
  1. HsSWEET1
  2. RAG1-activating protein 1
  3. Solute carrier family 50 member 1
  4. Stromal cell protein
Gene Name SLC50A1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Mediates sugar transport across membranes. May stimulate V(D)J recombination by the activation of RAG1.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
positive regulation of gene expression, epigenetic
carbohydrate transport
DNA recombination
Cellular Component
plasma membrane
Golgi apparatus
nucleus
endomembrane system
integral to membrane
Golgi membrane
Molecular Function
glucoside transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1q22
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 19050.135
Theoretical pI 9.247
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|170932479|ref|NP_001116309.1| sugar transporter SWEET1 isoform b [Homo sapiens]
MRGLHPWHVLRRPLGPQAHANDPECGQRPVPALSHHGSQRVVLLQTATLLGVLLLGYGYF
WLLVPNPEAR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9BRV3
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:30657
References
General References Not Available