Hmdb loader

Showing Protein General transcription factor IIF subunit 2 (HMDBP11969)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 4 metabolites
Identification
HMDB Protein ID HMDBP11969
Secondary Accession Numbers None
Name General transcription factor IIF subunit 2
Synonyms
  1. ATP-dependent helicase GTF2F2
  2. General transcription factor IIF 30 kDa subunit
  3. Transcription initiation factor IIF subunit beta
  4. Transcription initiation factor RAP30
  5. TFIIF-beta
Gene Name GTF2F2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. This subunit shows ATP-dependent DNA-helicase activity.
Pathways
  • Basal transcription factors
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
7-methylguanosine mRNA capping
mRNA splicing, via spliceosome
viral reproduction
positive regulation of transcription from RNA polymerase II promoter
positive regulation of viral transcription
transcription elongation from RNA polymerase II promoter
transcription initiation from RNA polymerase II promoter
Cellular Component
microtubule cytoskeleton
nucleoplasm
transcription factor TFIIF complex
Molecular Function
ATP binding
ATP-dependent helicase activity
DNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 13
Locus 13q14
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 28380.13
Theoretical pI 9.228
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>>gi|4758488|ref|NP_004119.1| general transcription factor IIF subunit 2 [Homo sapiens]
MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNE
DLANIHDIGG
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P13984
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:4653
References
General References Not Available