You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11970
Secondary Accession Numbers None
Name Putative ATP-dependent RNA helicase TDRD9
Synonyms
  1. Tudor domain-containing protein 9
Gene Name TDRD9
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Probable ATP-binding RNA helicase which plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Its association with PIWIL4 and the piP-bodies suggests a participation in the secondary piRNAs metabolic process (By similarity).
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
multicellular organismal development
spermatogenesis
male meiosis
cell differentiation
DNA methylation involved in gamete generation
gene silencing by RNA
piRNA metabolic process
fertilization
Cellular Component
nucleus
piP-body
Molecular Function
nucleic acid binding
ATP binding
ATP-dependent helicase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 14
Locus 14q32.33
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 155682.175
Theoretical pI 7.055
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|166851804|ref|NP_694591.2| putative ATP-dependent RNA helicase TDRD9 [Homo sapiens]
MLRKLTIEQINDWFTIGKTVTNVELLGAPPAFPAGAAREEVQRQDVAPGAGPAAQAPALA
QAPARPAAAF
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8NDG6
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20122
References
General References Not Available