You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11972
Secondary Accession Numbers None
Name Methylcytosine dioxygenase TET1
Synonyms
  1. CXXC-type zinc finger protein 6
  2. Leukemia-associated protein with a CXXC domain
  3. Ten-eleven translocation 1 gene protein
Gene Name TET1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Dioxygenase that catalyzes the conversion of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC). Might initiate a process leading to cytosine demethylation through deamination into 5-hydroxymethyluracil (5hmU) and subsequent replacement by unmethylated cytosine by the base excision repair system. Methylation at the C5 position of cytosine bases is an epigenetic modification of the mammalian genome which plays an important role in transcriptional regulation. Preferentially binds to CpG-rich sequences at promoters of both transcriptionally active and polycomb-repressed genes. By controlling the levels of 5mC and 5hmC at gene promoters, it may regulate the gene expression silencing induced by cytosine methylation. May have a dual function by also repressing the expression of a subset of genes through recruitment of transcriptional repressors to promoters. Involved in the balance between pluripotency and lineage commitment of cells it plays a role in embryonic stem cells maintenance and inner cell mass cell specification.
Pathways
  • The oncogenic action of 2-hydroxyglutarate
  • The oncogenic action of D-2-hydroxyglutarate in Hydroxygluaricaciduria
  • The Oncogenic Action of Fumarate
  • The oncogenic action of L-2-hydroxyglutarate in Hydroxygluaricaciduria
  • The Oncogenic Action of Succinate
Reactions
DNA 5-methylcytosine + Oxoglutaric acid + Oxygen → DNA 5-hydroxymethylcytosine + Succinic acid + CO(2) details
GO Classification
Biological Process
negative regulation of methylation-dependent chromatin silencing
chromatin modification
DNA demethylation
transcription, DNA-dependent
inner cell mass cell differentiation
stem cell maintenance
Cellular Component
nucleus
Molecular Function
methylcytosine dioxygenase activity
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
iron ion binding
zinc ion binding
structure-specific DNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 10
Locus 10q21
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 235306.965
Theoretical pI 8.23
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|156139122|ref|NP_085128.2| methylcytosine dioxygenase TET1 [Homo sapiens]
MSRSRHARPSRLVRKEDVNKKKKNSQLRKTTKGANKNVASVKTLSPGKLKQLIQERDVKK
KTEPKPPVPV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8NFU7
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:29484
References
General References Not Available