You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11973
Secondary Accession Numbers None
Name Methylcytosine dioxygenase TET2
Synonyms Not Available
Gene Name TET2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Catalyzes the conversion of methylcytosine (5mC) to 5-hydroxymethylcytosine (hmC). Plays an important role in myelopoiesis. The clear function of 5-hydroxymethylcytosine (hmC) is still unclear but it may influence chromatin structure and recruit specific factors or may constitute an intermediate component in cytosine demethylation.
Pathways Not Available
Reactions
DNA 5-methylcytosine + Oxoglutaric acid + Oxygen → DNA 5-hydroxymethylcytosine + Succinic acid + CO(2) details
GO Classification
Biological Process
cell cycle
kidney development
myeloid cell differentiation
post-embryonic development
Molecular Function
metal ion binding
methylcytosine dioxygenase activity
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus 4q24
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 223809.995
Theoretical pI 7.98
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|187761317|ref|NP_001120680.1| methylcytosine dioxygenase TET2 isoform a [Homo sapiens]
MEQDRTNHVEGNRLSPFLIPSPPICQTEPLATKLQNGSPLPERAHPEVNGDTKWHSFKSY
YGIPCMKGSQ
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q6N021
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:25941
References
General References Not Available