Showing Protein Fructose-2,6-bisphosphatase TIGAR (HMDBP11978)
Identification | |||||
---|---|---|---|---|---|
HMDB Protein ID | HMDBP11978 | ||||
Secondary Accession Numbers | None | ||||
Name | Fructose-2,6-bisphosphatase TIGAR | ||||
Synonyms |
|
||||
Gene Name | TIGAR | ||||
Protein Type | Unknown | ||||
Biological Properties | |||||
General Function | Not Available | ||||
Specific Function | Fructose-bisphosphatase hydrolyzing fructose-2,6-bisphosphate as well as fructose-1,6-bisphosphate. Inhibits glycolysis by reducing cellular levels of fructose-2,6-bisphosphate. May protect cells against reactive oxygen species and against apoptosis induced by tp53. | ||||
Pathways |
|
||||
Reactions |
|
||||
GO Classification |
|
||||
Cellular Location | Not Available | ||||
Gene Properties | |||||
Chromosome Location | 12 | ||||
Locus | 12p13.3 | ||||
SNPs | Not Available | ||||
Gene Sequence | Not Available | ||||
Protein Properties | |||||
Number of Residues | Not Available | ||||
Molecular Weight | 30062.295 | ||||
Theoretical pI | 7.691 | ||||
Pfam Domain Function | Not Available | ||||
Signals | Not Available | ||||
Transmembrane Regions | Not Available | ||||
Protein Sequence |
>>gi|9966849|ref|NP_065108.1| fructose-2,6-bisphosphatase TIGAR [Homo sapiens] MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLM RTKQTMHGIL |
||||
External Links | |||||
GenBank ID Protein | Not Available | ||||
UniProtKB/Swiss-Prot ID | Q9NQ88 | ||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||
PDB IDs | |||||
GenBank Gene ID | Not Available | ||||
GeneCard ID | Not Available | ||||
GenAtlas ID | Not Available | ||||
HGNC ID | HGNC:1185 | ||||
References | |||||
General References | Not Available |