Showing Protein Lysoplasmalogenase (HMDBP11979)
Identification | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11979 | |||||||||
Secondary Accession Numbers | None | |||||||||
Name | Lysoplasmalogenase | |||||||||
Synonyms |
|
|||||||||
Gene Name | TMEM86B | |||||||||
Protein Type | Unknown | |||||||||
Biological Properties | ||||||||||
General Function | Not Available | |||||||||
Specific Function | Enzyme catalyzing the degradation of lysoplasmalogen. Lysoplasmalogens are formed by the hydrolysis of the abundant membrane glycerophospholipids plasmalogens. May control the respective levels of plasmalogens and lysoplasmalogens in cells and modulate cell membrane properties. | |||||||||
Pathways | Not Available | |||||||||
Reactions |
|
|||||||||
GO Classification |
|
|||||||||
Cellular Location | Not Available | |||||||||
Gene Properties | ||||||||||
Chromosome Location | 19 | |||||||||
Locus | 19q13.42 | |||||||||
SNPs | Not Available | |||||||||
Gene Sequence | Not Available | |||||||||
Protein Properties | ||||||||||
Number of Residues | Not Available | |||||||||
Molecular Weight | 24351.695 | |||||||||
Theoretical pI | 6.637 | |||||||||
Pfam Domain Function |
|
|||||||||
Signals | Not Available | |||||||||
Transmembrane Regions | Not Available | |||||||||
Protein Sequence |
>>gi|281427107|ref|NP_776165.3| lysoplasmalogenase [Homo sapiens] MDAGKAGQTLKTHCSAQRPDVCRWLSPFILSCCVYFCLWIPEDQLSWFAALVKCLPVLCL AGFLWVMSPS |
|||||||||
External Links | ||||||||||
GenBank ID Protein | Not Available | |||||||||
UniProtKB/Swiss-Prot ID | Q8N661 | |||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||
PDB IDs | Not Available | |||||||||
GenBank Gene ID | Not Available | |||||||||
GeneCard ID | Not Available | |||||||||
GenAtlas ID | Not Available | |||||||||
HGNC ID | HGNC:28448 | |||||||||
References | ||||||||||
General References | Not Available |