Hmdb loader
Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11979
Secondary Accession Numbers None
Name Lysoplasmalogenase
Synonyms
  1. Transmembrane protein 86B
Gene Name TMEM86B
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Enzyme catalyzing the degradation of lysoplasmalogen. Lysoplasmalogens are formed by the hydrolysis of the abundant membrane glycerophospholipids plasmalogens. May control the respective levels of plasmalogens and lysoplasmalogens in cells and modulate cell membrane properties.
Pathways Not Available
Reactions
1-(1-alkenyl)-sn-glycero-3-phosphocholine + Water → an aldehyde + Glycerophosphocholine details
1-(1-alkenyl)-sn-glycero-3-phosphoethanolamine + Water → an aldehyde + sn-glycero-3-Phosphoethanolamine details
GO Classification
Biological Process
ether lipid metabolic process
Cellular Component
cytoplasmic part
membrane
integral to membrane
Molecular Function
alkenylglycerophosphocholine hydrolase activity
alkenylglycerophosphoethanolamine hydrolase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus 19q13.42
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 24351.695
Theoretical pI 6.637
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|281427107|ref|NP_776165.3| lysoplasmalogenase [Homo sapiens]
MDAGKAGQTLKTHCSAQRPDVCRWLSPFILSCCVYFCLWIPEDQLSWFAALVKCLPVLCL
AGFLWVMSPS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8N661
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:28448
References
General References Not Available