Showing Protein Mitochondrial thiamine pyrophosphate carrier (HMDBP11980)
| Identification | ||||||
|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11980 | |||||
| Secondary Accession Numbers | None | |||||
| Name | Mitochondrial thiamine pyrophosphate carrier | |||||
| Synonyms |
|
|||||
| Gene Name | SLC25A19 | |||||
| Protein Type | Unknown | |||||
| Biological Properties | ||||||
| General Function | Not Available | |||||
| Specific Function | Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria. | |||||
| Pathways | Not Available | |||||
| Reactions | Not Available | |||||
| GO Classification |
|
|||||
| Cellular Location | Not Available | |||||
| Gene Properties | ||||||
| Chromosome Location | 17 | |||||
| Locus | 17q25.3 | |||||
| SNPs | Not Available | |||||
| Gene Sequence | Not Available | |||||
| Protein Properties | ||||||
| Number of Residues | Not Available | |||||
| Molecular Weight | 35510.895 | |||||
| Theoretical pI | 9.56 | |||||
| Pfam Domain Function | Not Available | |||||
| Signals | Not Available | |||||
| Transmembrane Regions | Not Available | |||||
| Protein Sequence |
>>gi|186928858|ref|NP_001119593.1| mitochondrial thiamine pyrophosphate carrier [Homo sapiens] MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYH GILQASRQIL |
|||||
| External Links | ||||||
| GenBank ID Protein | Not Available | |||||
| UniProtKB/Swiss-Prot ID | Q9HC21 | |||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||
| PDB IDs | Not Available | |||||
| GenBank Gene ID | Not Available | |||||
| GeneCard ID | Not Available | |||||
| GenAtlas ID | Not Available | |||||
| HGNC ID | HGNC:14409 | |||||
| References | ||||||
| General References | Not Available | |||||