You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11980
Secondary Accession Numbers None
Name Mitochondrial thiamine pyrophosphate carrier
Synonyms
  1. Mitochondrial uncoupling protein 1
  2. Solute carrier family 25 member 19
Gene Name SLC25A19
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria.
Pathways Not Available
Reactions Not Available
GO Classification
Cellular Component
integral to membrane
mitochondrial inner membrane
Molecular Function
deoxynucleotide transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus 17q25.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 35510.895
Theoretical pI 9.56
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|186928858|ref|NP_001119593.1| mitochondrial thiamine pyrophosphate carrier [Homo sapiens]
MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYH
GILQASRQIL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9HC21
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:14409
References
General References Not Available