You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Probable tRNA (uracil-O(2)-)-methyltransferase (HMDBP11983)
Identification | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11983 | |||||||||
Secondary Accession Numbers | None | |||||||||
Name | Probable tRNA (uracil-O(2)-)-methyltransferase | |||||||||
Synonyms |
|
|||||||||
Gene Name | TRMT44 | |||||||||
Protein Type | Unknown | |||||||||
Biological Properties | ||||||||||
General Function | Not Available | |||||||||
Specific Function | Probable adenosyl-L-methionine (AdoMet)-dependent tRNA (uracil-O(2)-)-methyltransferase (By similarity). | |||||||||
Pathways | Not Available | |||||||||
Reactions |
|
|||||||||
GO Classification |
|
|||||||||
Cellular Location | Not Available | |||||||||
Gene Properties | ||||||||||
Chromosome Location | 4 | |||||||||
Locus | 4p16.1 | |||||||||
SNPs | Not Available | |||||||||
Gene Sequence | Not Available | |||||||||
Protein Properties | ||||||||||
Number of Residues | Not Available | |||||||||
Molecular Weight | 84628.16 | |||||||||
Theoretical pI | 7.271 | |||||||||
Pfam Domain Function |
|
|||||||||
Signals | Not Available | |||||||||
Transmembrane Regions | Not Available | |||||||||
Protein Sequence |
>>gi|298160987|ref|NP_689757.2| probable tRNA (uracil-O(2)-)-methyltransferase [Homo sapiens] MAEVGRTGISYPGALLPQGFWAAVEVWLERPQVANKRLCGARLEARWSAALPCAEARGPG TSAGSEQKER |
|||||||||
External Links | ||||||||||
GenBank ID Protein | Not Available | |||||||||
UniProtKB/Swiss-Prot ID | Q8IYL2 | |||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||
PDB IDs | Not Available | |||||||||
GenBank Gene ID | Not Available | |||||||||
GeneCard ID | Not Available | |||||||||
GenAtlas ID | Not Available | |||||||||
HGNC ID | HGNC:26653 | |||||||||
References | ||||||||||
General References | Not Available |