Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11983
Secondary Accession Numbers None
Name Probable tRNA (uracil-O(2)-)-methyltransferase
Synonyms
  1. Methyltransferase-like protein 19
Gene Name TRMT44
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Probable adenosyl-L-methionine (AdoMet)-dependent tRNA (uracil-O(2)-)-methyltransferase (By similarity).
Pathways Not Available
Reactions
S-Adenosylmethionine + uridine(44) in tRNA(Ser) → S-Adenosylhomocysteine + 2'-O-methyluridine(44) in tRNA(Ser) details
GO Classification
Biological Process
tRNA processing
Cellular Component
cytoplasm
Molecular Function
nucleic acid binding
metal ion binding
zinc ion binding
methyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus 4p16.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 84628.16
Theoretical pI 7.271
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|298160987|ref|NP_689757.2| probable tRNA (uracil-O(2)-)-methyltransferase [Homo sapiens]
MAEVGRTGISYPGALLPQGFWAAVEVWLERPQVANKRLCGARLEARWSAALPCAEARGPG
TSAGSEQKER
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8IYL2
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:26653
References
General References Not Available