| Identification |
| HMDB Protein ID
| HMDBP11984 |
| Secondary Accession Numbers
| None |
| Name
| Terminal uridylyltransferase 4 |
| Synonyms
|
- TUTase 4
- Zinc finger CCHC domain-containing protein 11
|
| Gene Name
| ZCCHC11 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Uridylyltransferase that acts as a suppressor of microRNA (miRNA) biogenesis by specifically mediating the terminal uridylation of some miRNAs. Catalyzes the 3' uridylation of precursor let-7 (pre-let-7), a miRNA precursor. Uridylated pre-let-7 miRNAs fail to be processed by Dicer and undergo degradation. Degradation of pre-let-7 contributes to the maintenance of embryonic stem (ES) cells and is required for ES cells to maintain pluripotency. Does not bind RNA by itself, recruited to pre-let-7 miRNAs via its interaction with LIN28A and LIN28B. Also catalyzes the 3' uridylation of miR-26A, a miRNA that represses IL6 transcript, leading to abrogate IL6 transcript repression and promote cytokine expression. May also suppress Toll-like receptor-induced NF-kappa-B activity via binding to T2BP. Does not play a role in replication-dependent histone mRNA degradation.
|
| Pathways
|
Not Available
|
| Reactions
|
| Uridine triphosphate + RNA(n) → Pyrophosphate + RNA(n+1) |
details
|
|
| GO Classification
|
| Biological Process |
| miRNA catabolic process |
| pre-miRNA processing |
| regulation of lipopolysaccharide-mediated signaling pathway |
| RNA 3'-end processing |
| cytokine production |
| negative regulation of NF-kappaB transcription factor activity |
| stem cell maintenance |
| Cellular Component |
| cytoplasm |
| nucleolus |
| Molecular Function |
| nucleic acid binding |
| metal ion binding |
| RNA uridylyltransferase activity |
| zinc ion binding |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 1 |
| Locus
| 1p32.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 185251.0 |
| Theoretical pI
| 7.979 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|57863248|ref|NP_001009881.1| terminal uridylyltransferase 4 isoform a [Homo sapiens]
MEESKTLKSENHEPKKNVICEESKAVQVIGNQTLKARNDKSVKEIENSSPNRNSSKKNKQ
NDICIEKTEV
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q5TAX3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:28981 |
| References |
| General References
| Not Available |