Showing Protein Ubiquitin-conjugating enzyme E2Q-like protein 1 (HMDBP11986)
Identification | ||||
---|---|---|---|---|
HMDB Protein ID | HMDBP11986 | |||
Secondary Accession Numbers | None | |||
Name | Ubiquitin-conjugating enzyme E2Q-like protein 1 | |||
Synonyms | Not Available | |||
Gene Name | UBE2QL1 | |||
Protein Type | Unknown | |||
Biological Properties | ||||
General Function | Not Available | |||
Specific Function | Catalyzes the covalent attachment of ubiquitin to other proteins (Potential). | |||
Pathways |
|
|||
Reactions |
|
|||
GO Classification |
|
|||
Cellular Location | Not Available | |||
Gene Properties | ||||
Chromosome Location | 5 | |||
Locus | 5p15.31 | |||
SNPs | Not Available | |||
Gene Sequence | Not Available | |||
Protein Properties | ||||
Number of Residues | Not Available | |||
Molecular Weight | 18337.93 | |||
Theoretical pI | 7.961 | |||
Pfam Domain Function | Not Available | |||
Signals | Not Available | |||
Transmembrane Regions | Not Available | |||
Protein Sequence |
>>gi|223555979|ref|NP_001138633.1| ubiquitin-conjugating enzyme E2Q-like protein 1 [Homo sapiens] MKELQDIARLSDRFISVELVDESLFDWNVKLHQVDKDSVLWQDMKETNTEFILLNLTFPD NFPFSPPFMR |
|||
External Links | ||||
GenBank ID Protein | Not Available | |||
UniProtKB/Swiss-Prot ID | A1L167 | |||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||
PDB IDs | Not Available | |||
GenBank Gene ID | Not Available | |||
GeneCard ID | Not Available | |||
GenAtlas ID | Not Available | |||
HGNC ID | HGNC:37269 | |||
References | ||||
General References | Not Available |