Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11989
Secondary Accession Numbers None
Name Ubiquitin-conjugating enzyme E2 G2
Synonyms
  1. Ubiquitin carrier protein G2
  2. Ubiquitin-protein ligase G2
Gene Name UBE2G2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Involved in endoplasmic reticulum-associated degradation (ERAD).
Pathways
  • Parkinson's disease
  • Protein processing in endoplasmic reticulum
  • protein ubiquitination
  • Ubiquitin mediated proteolysis
Reactions
Adenosine triphosphate + ubiquitin + protein lysine → Adenosine monophosphate + Pyrophosphate + protein N-ubiquityllysine details
GO Classification
Biological Process
protein K48-linked ubiquitination
protein N-linked glycosylation via asparagine
ER-associated protein catabolic process
Cellular Component
cytosol
endoplasmic reticulum
Molecular Function
ubiquitin-protein ligase activity
ATP binding
Cellular Location Not Available
Gene Properties
Chromosome Location 21
Locus 21q22.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 10762.16
Theoretical pI 5.158
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|321117279|ref|NP_001189418.1| ubiquitin-conjugating enzyme E2 G2 isoform 3 [Homo sapiens]
MRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEP
NDESGANVDA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P60604
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:12483
References
General References Not Available