Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11990
Secondary Accession Numbers None
Name Ubiquitin-conjugating enzyme E2 Q1
Synonyms
  1. Protein NICE-5
  2. Ubiquitin carrier protein Q1
  3. Ubiquitin-protein ligase Q1
Gene Name UBE2Q1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity).
Pathways
  • protein ubiquitination
  • Ubiquitin mediated proteolysis
Reactions
Adenosine triphosphate + ubiquitin + protein lysine → Adenosine monophosphate + Pyrophosphate + protein N-ubiquityllysine details
GO Classification
Molecular Function
ubiquitin-protein ligase activity
ATP binding
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1q21.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 46126.575
Theoretical pI 5.091
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|31543906|ref|NP_060052.3| ubiquitin-conjugating enzyme E2 Q1 [Homo sapiens]
MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCLRRELKLLESIFHRGHERFR
IASACLDELS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q7Z7E8
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:15698
References
General References Not Available