Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11993
Secondary Accession Numbers None
Name Ubiquitin-conjugating enzyme E2 K
Synonyms
  1. Huntingtin-interacting protein 2
  2. Ubiquitin carrier protein
  3. Ubiquitin-conjugating enzyme E2-25 kDa
  4. Ubiquitin-protein ligase
  5. HIP-2
  6. Ubiquitin-conjugating enzyme E2(25K)
  7. Ubiquitin-conjugating enzyme E2-25K
Gene Name UBE2K
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, in the presence or in the absence of BRCA1-BARD1 E3 ubiquitin-protein ligase complex, catalyzes the synthesis of 'Lys-48'-linked polyubiquitin chains. Does not transfer ubiquitin directly to but elongates monoubiquitinated substrate protein. Mediates the selective degradation of short-lived and abnormal proteins, such as the endoplasmic reticulum-associated degradation (ERAD) of misfolded lumenal proteins. Ubiquitinates huntingtin. May mediate foam cell formation by the suppression of apoptosis of lipid-bearing macrophages through ubiquitination and subsequence degradation of p53/TP53. Proposed to be involved in ubiquitination and proteolytic processing of NF-kappa-B; in vitro supports ubiquitination of NFKB1. In case of infection by cytomegaloviruses may be involved in the US11-dependent degradation of MHC class I heavy chains following their export from the ER to the cytosol. In case of viral infections may be involved in the HPV E7 protein-dependent degradation of RB1.
Pathways
  • protein ubiquitination
  • Ubiquitin mediated proteolysis
Reactions
Adenosine triphosphate + ubiquitin + protein lysine → Adenosine monophosphate + Pyrophosphate + protein N-ubiquityllysine details
GO Classification
Biological Process
protein K48-linked ubiquitination
ubiquitin-dependent protein catabolic process
Cellular Component
cytoplasm
Molecular Function
ATP binding
ubiquitin-ubiquitin ligase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus 4p14
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 16618.01
Theoretical pI 6.551
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|163660387|ref|NP_001104583.1| ubiquitin-conjugating enzyme E2 K isoform 3 [Homo sapiens]
MANIAVQRIKREFKEVLKSEEVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLL
SLQALLAAAE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P61086
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:4914
References
General References Not Available