You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11994
Secondary Accession Numbers None
Name Ubiquitin-conjugating enzyme E2 T
Synonyms
  1. Cell proliferation-inducing gene 50 protein
  2. Ubiquitin carrier protein T
  3. Ubiquitin-protein ligase T
Gene Name UBE2T
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes monoubiquitination. Involved in mitomycin-C (MMC)-induced DNA repair: acts as a specific E2 ubiquitin-conjugating enzyme for the Fanconi anemia complex by associating with E3 ubiquitin-protein ligase FANCL and catalyzing monoubiquitination of FANCD2, a key step in the DNA damage pathway. Also mediates monoubiquitination of FANCL and FANCI. May contribute to ubiquitination and degradation of BRCA1. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11'-, 'Lys-27'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination.
Pathways
  • Fanconi anemia pathway
  • protein ubiquitination
Reactions
Adenosine triphosphate + ubiquitin + protein lysine → Adenosine monophosphate + Pyrophosphate + protein N-ubiquityllysine details
GO Classification
Biological Process
DNA repair
protein K48-linked ubiquitination
protein K11-linked ubiquitination
protein monoubiquitination
protein K27-linked ubiquitination
protein K29-linked ubiquitination
protein K6-linked ubiquitination
protein K63-linked ubiquitination
protein autoubiquitination
Cellular Component
nucleoplasm
Molecular Function
ubiquitin-protein ligase activity
ATP binding
chromatin binding
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1q32.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 22520.65
Theoretical pI 7.991
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|7661808|ref|NP_054895.1| ubiquitin-conjugating enzyme E2 T [Homo sapiens]
MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPER
YPFEPPQIRF
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NPD8
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:25009
References
General References Not Available