You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification |
HMDB Protein ID
| HMDBP11994 |
Secondary Accession Numbers
| None |
Name
| Ubiquitin-conjugating enzyme E2 T |
Synonyms
|
- Cell proliferation-inducing gene 50 protein
- Ubiquitin carrier protein T
- Ubiquitin-protein ligase T
|
Gene Name
| UBE2T |
Protein Type
| Unknown |
Biological Properties |
General Function
| Not Available |
Specific Function
| Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes monoubiquitination. Involved in mitomycin-C (MMC)-induced DNA repair: acts as a specific E2 ubiquitin-conjugating enzyme for the Fanconi anemia complex by associating with E3 ubiquitin-protein ligase FANCL and catalyzing monoubiquitination of FANCD2, a key step in the DNA damage pathway. Also mediates monoubiquitination of FANCL and FANCI. May contribute to ubiquitination and degradation of BRCA1. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11'-, 'Lys-27'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination.
|
Pathways
|
- Fanconi anemia pathway
- protein ubiquitination
|
Reactions
|
Adenosine triphosphate + ubiquitin + protein lysine → Adenosine monophosphate + Pyrophosphate + protein N-ubiquityllysine |
details
|
|
GO Classification
|
Biological Process |
DNA repair |
protein K48-linked ubiquitination |
protein K11-linked ubiquitination |
protein monoubiquitination |
protein K27-linked ubiquitination |
protein K29-linked ubiquitination |
protein K6-linked ubiquitination |
protein K63-linked ubiquitination |
protein autoubiquitination |
Cellular Component |
nucleoplasm |
Molecular Function |
ubiquitin-protein ligase activity |
ATP binding |
chromatin binding |
|
Cellular Location
|
Not Available
|
Gene Properties |
Chromosome Location
| 1 |
Locus
| 1q32.1 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 22520.65 |
Theoretical pI
| 7.991 |
Pfam Domain Function
|
Not Available |
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>>gi|7661808|ref|NP_054895.1| ubiquitin-conjugating enzyme E2 T [Homo sapiens]
MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPER
YPFEPPQIRF
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| Q9NPD8 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
|
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:25009 |
References |
General References
| Not Available |