Showing Protein UDP-glucuronosyltransferase 3A1 (HMDBP11996)
| Identification | ||||||
|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11996 | |||||
| Secondary Accession Numbers | None | |||||
| Name | UDP-glucuronosyltransferase 3A1 | |||||
| Synonyms |
|
|||||
| Gene Name | UGT3A1 | |||||
| Protein Type | Unknown | |||||
| Biological Properties | ||||||
| General Function | Not Available | |||||
| Specific Function | UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds (By similarity). | |||||
| Pathways | Not Available | |||||
| Reactions |
|
|||||
| GO Classification |
|
|||||
| Cellular Location | Not Available | |||||
| Gene Properties | ||||||
| Chromosome Location | 5 | |||||
| Locus | 5p13.2 | |||||
| SNPs | Not Available | |||||
| Gene Sequence | Not Available | |||||
| Protein Properties | ||||||
| Number of Residues | Not Available | |||||
| Molecular Weight | 29185.405 | |||||
| Theoretical pI | 6.071 | |||||
| Pfam Domain Function | Not Available | |||||
| Signals | Not Available | |||||
| Transmembrane Regions | Not Available | |||||
| Protein Sequence |
>>gi|288541304|ref|NP_001165344.1| UDP-glucuronosyltransferase 3A1 isoform 2 [Homo sapiens] MLHQSGKFLIPDIKEEEKSYQVIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLM EIFGTQCSYL |
|||||
| External Links | ||||||
| GenBank ID Protein | Not Available | |||||
| UniProtKB/Swiss-Prot ID | Q6NUS8 | |||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||
| PDB IDs | Not Available | |||||
| GenBank Gene ID | Not Available | |||||
| GeneCard ID | Not Available | |||||
| GenAtlas ID | Not Available | |||||
| HGNC ID | HGNC:26625 | |||||
| References | ||||||
| General References | Not Available | |||||