You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11998
Secondary Accession Numbers None
Name Putative 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase
Synonyms
  1. OHCU decarboxylase
  2. Parahox neighbor
Gene Name PRHOXNB
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Catalyzes the stereoselective decarboxylation of 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline (OHCU) to (S)-allantoin (Potential).
Pathways
  • Purine metabolism
  • urate degradation
Reactions
5-hydroxy-2-oxo-4-ureido-2,5-dihydro-1H-imidazole-5-carboxylate → Allantoin + CO(2) details
GO Classification
Biological Process
purine nucleobase metabolic process
allantoin biosynthetic process
urate catabolic process
Cellular Component
peroxisome
Molecular Function
carboxy-lyase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 13
Locus 13q12.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 19129.52
Theoretical pI 6.051
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|157743280|ref|NP_001099047.1| putative 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase [Homo sapiens]
MDIEKVNSMDLGEFVDVFGNATERCPLIAAAVWSQRPFSDLEDLEKHFFAFIDALAQSGQ
EGILRCHPDL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID A6NGE7
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17785
References
General References Not Available