Showing Protein Putative 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (HMDBP11998)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11998 | ||||||||
| Secondary Accession Numbers | None | ||||||||
| Name | Putative 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase | ||||||||
| Synonyms |
|
||||||||
| Gene Name | PRHOXNB | ||||||||
| Protein Type | Unknown | ||||||||
| Biological Properties | |||||||||
| General Function | Not Available | ||||||||
| Specific Function | Catalyzes the stereoselective decarboxylation of 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline (OHCU) to (S)-allantoin (Potential). | ||||||||
| Pathways |
|
||||||||
| Reactions |
|
||||||||
| GO Classification |
|
||||||||
| Cellular Location | Not Available | ||||||||
| Gene Properties | |||||||||
| Chromosome Location | 13 | ||||||||
| Locus | 13q12.2 | ||||||||
| SNPs | Not Available | ||||||||
| Gene Sequence | Not Available | ||||||||
| Protein Properties | |||||||||
| Number of Residues | Not Available | ||||||||
| Molecular Weight | 19129.52 | ||||||||
| Theoretical pI | 6.051 | ||||||||
| Pfam Domain Function |
|
||||||||
| Signals | Not Available | ||||||||
| Transmembrane Regions | Not Available | ||||||||
| Protein Sequence |
>>gi|157743280|ref|NP_001099047.1| putative 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase [Homo sapiens] MDIEKVNSMDLGEFVDVFGNATERCPLIAAAVWSQRPFSDLEDLEKHFFAFIDALAQSGQ EGILRCHPDL |
||||||||
| External Links | |||||||||
| GenBank ID Protein | Not Available | ||||||||
| UniProtKB/Swiss-Prot ID | A6NGE7 | ||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
| PDB IDs | Not Available | ||||||||
| GenBank Gene ID | Not Available | ||||||||
| GeneCard ID | Not Available | ||||||||
| GenAtlas ID | Not Available | ||||||||
| HGNC ID | HGNC:17785 | ||||||||
| References | |||||||||
| General References | Not Available | ||||||||