Showing Protein Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 (HMDBP12000)
Identification | ||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP12000 | |||||||||||||
Secondary Accession Numbers | None | |||||||||||||
Name | Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 | |||||||||||||
Synonyms |
|
|||||||||||||
Gene Name | PPIP5K1 | |||||||||||||
Protein Type | Unknown | |||||||||||||
Biological Properties | ||||||||||||||
General Function | Not Available | |||||||||||||
Specific Function | Bifunctional inositol kinase that catalyzes the formation of diphosphoinositol pentakisphosphate (InsP7 or PP-InsP5) and bi-diphosphoinositol tetrakisphosphate (InsP8 or PP2-InsP4). Converts inositolitol hexakisphosphate (InsP6) to InsP7. Also able to convert InsP7 to InsP8. Probably specifically mediates the formation of 4PP-InsP5 and 6PP-InsP5 InsP7 isomers but not of 5PP-IP5 InsP7 isomer. Activated when cells are exposed to hyperosmotic stress. | |||||||||||||
Pathways |
|
|||||||||||||
Reactions |
|
|||||||||||||
GO Classification |
|
|||||||||||||
Cellular Location | Not Available | |||||||||||||
Gene Properties | ||||||||||||||
Chromosome Location | 15 | |||||||||||||
Locus | 15q15.3 | |||||||||||||
SNPs | Not Available | |||||||||||||
Gene Sequence | Not Available | |||||||||||||
Protein Properties | ||||||||||||||
Number of Residues | Not Available | |||||||||||||
Molecular Weight | 159519.82 | |||||||||||||
Theoretical pI | 5.399 | |||||||||||||
Pfam Domain Function | Not Available | |||||||||||||
Signals | Not Available | |||||||||||||
Transmembrane Regions | Not Available | |||||||||||||
Protein Sequence |
>>gi|195947359|ref|NP_001124330.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 isoform 5 [Homo sapiens] MWSLTASEGESTTAHFFLGAGDEGLGTRGIGMRPEESDSELLEDEEDEVPPEPQIIVGIC AMTKKSKSKP |
|||||||||||||
External Links | ||||||||||||||
GenBank ID Protein | Not Available | |||||||||||||
UniProtKB/Swiss-Prot ID | Q6PFW1 | |||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||||||
PDB IDs | Not Available | |||||||||||||
GenBank Gene ID | Not Available | |||||||||||||
GeneCard ID | Not Available | |||||||||||||
GenAtlas ID | Not Available | |||||||||||||
HGNC ID | HGNC:29023 | |||||||||||||
References | ||||||||||||||
General References | Not Available |