Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP12001
Secondary Accession Numbers None
Name Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2
Synonyms
  1. Diphosphoinositol pentakisphosphate kinase 2
  2. Histidine acid phosphatase domain-containing protein 1
  3. InsP6 and PP-IP5 kinase 2
  4. VIP1 homolog 2
  5. hsVIP2
Gene Name PPIP5K2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Bifunctional inositol kinase that catalyzes the formation of diphosphoinositol pentakisphosphate (InsP7 or PP-InsP5) and bi-diphosphoinositol tetrakisphosphate (InsP8 or PP2-InsP4). Converts inositolitol hexakisphosphate (InsP6) to InsP7. Also able to convert InsP7 to InsP8. Probably specifically mediates the formation of 4PP-InsP5 and 6PP-InsP5 InsP7 isomers but not of 5PP-IP5 InsP7 isomer.
Pathways Not Available
Reactions
Adenosine triphosphate + 1D-myo-inositol hexakisphosphate → ADP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate details
Adenosine triphosphate + 1D-myo-inositol 1,3,4,5,6-pentakisphosphate → ADP + 1D-myo-inositol diphosphate tetrakisphosphate (isomeric configuration unknown) details
Adenosine triphosphate + 1D-myo-inositol 5-diphosphate pentakisphosphate → ADP + 1D-myo-inositol bisdiphosphate tetrakisphosphate (isomeric configuration unknown) details
Adenosine triphosphate + 5-Diphosphoinositol pentakisphosphate → ADP + 1D-myo-Inositol bisdiphosphate tetrakisphosphate details
GO Classification
Biological Process
inositol metabolic process
Cellular Component
cytosol
Molecular Function
kinase activity
ATP binding
diphosphoinositol-pentakisphosphate kinase activity
inositol hexakisphosphate 1-kinase activity
inositol hexakisphosphate 3-kinase activity
inositol hexakisphosphate 5-kinase activity
inositol-1,3,4,5,6-pentakisphosphate kinase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5q21.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 138104.925
Theoretical pI 8.056
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|41281583|ref|NP_056031.2| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 isoform 2 [Homo sapiens]
MSEAPRFFVGPEDTEINPGNYRHFFHHADEDDEEEDDSPPERQIVVGICSMAKKSKSKPM
KEILERISLF
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O43314
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:29035
References
General References Not Available