Showing Protein Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 (HMDBP12001)
Identification | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP12001 | ||||||||||||
Secondary Accession Numbers | None | ||||||||||||
Name | Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 | ||||||||||||
Synonyms |
|
||||||||||||
Gene Name | PPIP5K2 | ||||||||||||
Protein Type | Unknown | ||||||||||||
Biological Properties | |||||||||||||
General Function | Not Available | ||||||||||||
Specific Function | Bifunctional inositol kinase that catalyzes the formation of diphosphoinositol pentakisphosphate (InsP7 or PP-InsP5) and bi-diphosphoinositol tetrakisphosphate (InsP8 or PP2-InsP4). Converts inositolitol hexakisphosphate (InsP6) to InsP7. Also able to convert InsP7 to InsP8. Probably specifically mediates the formation of 4PP-InsP5 and 6PP-InsP5 InsP7 isomers but not of 5PP-IP5 InsP7 isomer. | ||||||||||||
Pathways | Not Available | ||||||||||||
Reactions |
|
||||||||||||
GO Classification |
|
||||||||||||
Cellular Location | Not Available | ||||||||||||
Gene Properties | |||||||||||||
Chromosome Location | 5 | ||||||||||||
Locus | 5q21.1 | ||||||||||||
SNPs | Not Available | ||||||||||||
Gene Sequence | Not Available | ||||||||||||
Protein Properties | |||||||||||||
Number of Residues | Not Available | ||||||||||||
Molecular Weight | 138104.925 | ||||||||||||
Theoretical pI | 8.056 | ||||||||||||
Pfam Domain Function | Not Available | ||||||||||||
Signals | Not Available | ||||||||||||
Transmembrane Regions | Not Available | ||||||||||||
Protein Sequence |
>>gi|41281583|ref|NP_056031.2| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 isoform 2 [Homo sapiens] MSEAPRFFVGPEDTEINPGNYRHFFHHADEDDEEEDDSPPERQIVVGICSMAKKSKSKPM KEILERISLF |
||||||||||||
External Links | |||||||||||||
GenBank ID Protein | Not Available | ||||||||||||
UniProtKB/Swiss-Prot ID | O43314 | ||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||
PDB IDs | |||||||||||||
GenBank Gene ID | Not Available | ||||||||||||
GeneCard ID | Not Available | ||||||||||||
GenAtlas ID | Not Available | ||||||||||||
HGNC ID | HGNC:29035 | ||||||||||||
References | |||||||||||||
General References | Not Available |