You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP12002
Secondary Accession Numbers None
Name Vascular non-inflammatory molecule 2
Synonyms
  1. Vanin-2
  2. Glycosylphosphatidyl inositol-anchored protein GPI-80
  3. Protein FOAP-4
Gene Name VNN2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine. Involved in the thymus homing of bone marrow cells. May regulate beta-2 integrin-mediated cell adhesion, migration and motility of neutrophil.
Pathways
  • Pantothenate and CoA biosynthesis
Reactions
Pantetheine + Water → Pantothenic acid + Cysteamine details
GO Classification
Biological Process
cellular component movement
pantothenate metabolic process
nitrogen compound metabolic process
Cellular Component
anchored to membrane
plasma membrane
Molecular Function
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
pantetheine hydrolase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6q23-q24
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 33256.93
Theoretical pI 6.121
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|334278906|ref|NP_001229279.1| vascular non-inflammatory molecule 2 isoform 3 precursor [Homo sapiens]
MVTSSFPISVAVFALITLQVGTQDSFIAAVYEHAVILPNKTETPVSQEDALNLMNENIDI
LETAIKQAAE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O95498
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:12706
References
General References Not Available