Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP12004
Secondary Accession Numbers None
Name Vacuolar protein sorting-associated protein 29
Synonyms
  1. hVPS29
  2. PEP11 homolog
  3. Vesicle protein sorting 29
Gene Name VPS29
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Essential component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Also required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA). Has low protein phosphatase activity towards a serine-phosphorylated peptide derived from IGF2R (in vitro).
Pathways Not Available
Reactions
O-phospho-L(or D)-serine + Water → L(or D)-serine + Phosphate details
GO Classification
Biological Process
protein transport
Cellular Component
endosome membrane
endosome
Molecular Function
metal ion binding
phosphoserine phosphatase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 12
Locus 12q24
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 20505.595
Theoretical pI 6.791
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|7706441|ref|NP_057310.1| vacuolar protein sorting-associated protein 29 isoform 1 [Homo sapiens]
MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVR
GDFDENLNYP
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9UBQ0
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:14340
References
General References Not Available