Showing Protein Xyloside xylosyltransferase 1 (HMDBP12008)
| Identification | ||||||
|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP12008 | |||||
| Secondary Accession Numbers | None | |||||
| Name | Xyloside xylosyltransferase 1 | |||||
| Synonyms |
|
|||||
| Gene Name | XXYLT1 | |||||
| Protein Type | Unknown | |||||
| Biological Properties | ||||||
| General Function | Not Available | |||||
| Specific Function | Alpha-1,3-xylosyltransferase, which elongates the O-linked xylose-glucose disaccharide attached to EGF-like repeats in the extracellular domain of Notch proteins by catalyzing the addition of the second xylose. | |||||
| Pathways | Not Available | |||||
| Reactions |
|
|||||
| GO Classification |
|
|||||
| Cellular Location | Not Available | |||||
| Gene Properties | ||||||
| Chromosome Location | 3 | |||||
| Locus | 3q29 | |||||
| SNPs | Not Available | |||||
| Gene Sequence | Not Available | |||||
| Protein Properties | ||||||
| Number of Residues | Not Available | |||||
| Molecular Weight | 43806.33 | |||||
| Theoretical pI | 8.134 | |||||
| Pfam Domain Function | Not Available | |||||
| Signals | Not Available | |||||
| Transmembrane Regions | Not Available | |||||
| Protein Sequence |
>>gi|112181295|ref|NP_689744.3| xyloside xylosyltransferase 1 [Homo sapiens] MGLLRGGLPCARAMARLGAVRSHYCALLLAAALAVCAFYYLGSGRETFSSATKRLKEARA GAPAAPSPPA |
|||||
| External Links | ||||||
| GenBank ID Protein | Not Available | |||||
| UniProtKB/Swiss-Prot ID | Q8NBI6 | |||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||
| PDB IDs | Not Available | |||||
| GenBank Gene ID | Not Available | |||||
| GeneCard ID | Not Available | |||||
| GenAtlas ID | Not Available | |||||
| HGNC ID | HGNC:26639 | |||||
| References | ||||||
| General References | Not Available | |||||