You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP12009
Secondary Accession Numbers None
Name Glycosaminoglycan xylosylkinase
Synonyms
  1. Protein FAM20B
  2. Xylose kinase
Gene Name FAM20B
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Responsible for the 2-O-phosphorylation of xylose in the glycosaminoglycan-protein linkage region of proteoglycans thereby regulating the amount of mature GAG chains. Sulfated glycosaminoglycans (GAGs), including heparan sulfate and chondroitin sulfate, are synthesized on the so-called common GAG-protein linkage region (GlcUAbeta1-3Galbeta1-3Galbeta1-4Xylbeta1-O-Ser) of core proteins, which is formed by the stepwise addition of monosaccharide residues by the respective specific glycosyltransferases. Xylose 2-o-phosphorylation may influence the catalytic activity of B3GAT3 (GlcAT-I) which completes the precursor tetrasaccharide of GAG-protein linkage regions on which the repeating disaccharide region is synthesized.
Pathways Not Available
Reactions
Adenosine triphosphate + D-Xylose → ADP + D-xylose 2-phosphate details
GO Classification
Cellular Component
Golgi apparatus
integral to membrane
Golgi membrane
Molecular Function
kinase activity
phosphotransferase activity, alcohol group as acceptor
ATP binding
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1q25
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 46432.04
Theoretical pI 6.88
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|7662150|ref|NP_055679.1| glycosaminoglycan xylosylkinase [Homo sapiens]
MKLKQRVVLLAILLVIFIFTKVFLIDNLDTSAANREDQRAFHRMMTGLRVELAPKLDHTL
QSPWEIAAQW
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O75063
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:23017
References
General References Not Available