| Identification |
|---|
| HMDB Protein ID
| HMDBP12013 |
| Secondary Accession Numbers
| None |
| Name
| Palmitoyltransferase ZDHHC13 |
| Synonyms
|
- Huntingtin-interacting protein 14-related protein
- Huntingtin-interacting protein HIP3RP
- Putative MAPK-activating protein PM03
- Putative NF-kappa-B-activating protein 209
- Zinc finger DHHC domain-containing protein 13
- HIP14-related protein
- DHHC-13
|
| Gene Name
| ZDHHC13 |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Palmitoyltransferase for HD and GAD2 (By similarity). Mediates Mg(2+) transport (By similarity).
|
| Pathways
|
Not Available
|
| Reactions
|
| Palmityl-CoA + protein-cysteine → S-palmitoyl protein + Coenzyme A |
details
|
|
| GO Classification
|
| Biological Process |
| positive regulation of I-kappaB kinase/NF-kappaB cascade |
| Cellular Component |
| Golgi-associated vesicle membrane |
| integral to membrane |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| signal transducer activity |
| magnesium ion transmembrane transporter activity |
| palmitoyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 11 |
| Locus
| 11p15.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 56508.075 |
| Theoretical pI
| 8.433 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|47933348|ref|NP_001001483.1| palmitoyltransferase ZDHHC13 isoform 2 [Homo sapiens]
MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDVNGQTPLMLSA
HKVIGPEPTG
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8IUH4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18413 |
| References |
|---|
| General References
| Not Available |
