| Identification |
|---|
| HMDB Protein ID
| HMDBP12016 |
| Secondary Accession Numbers
| None |
| Name
| Probable palmitoyltransferase ZDHHC16 |
| Synonyms
|
- Zinc finger DHHC domain-containing protein 16
- DHHC-16
|
| Gene Name
| ZDHHC16 |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| May be involved in apoptosis regulation (By similarity).
|
| Pathways
|
Not Available
|
| Reactions
|
| Palmityl-CoA + protein-cysteine → S-palmitoyl protein + Coenzyme A |
details
|
|
| GO Classification
|
| Biological Process |
| apoptotic process |
| Cellular Component |
| endoplasmic reticulum membrane |
| integral to membrane |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| transferase activity, transferring acyl groups |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 10 |
| Locus
| 10q24.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 43632.89 |
| Theoretical pI
| 9.626 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|37594455|ref|NP_115703.2| probable palmitoyltransferase ZDHHC16 isoform 1 precursor [Homo sapiens]
MRGQRSLLLGPARLCLRLLLLLGYRRRCPPLLRGLVQRWRYGKVCLRSLLYNSFGGSDTA
VDAAFEPVYW
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q969W1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20714 |
| References |
|---|
| General References
| Not Available |
