You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Probable palmitoyltransferase ZDHHC1 (HMDBP12025)
Identification | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP12025 | |||||||||
Secondary Accession Numbers | None | |||||||||
Name | Probable palmitoyltransferase ZDHHC1 | |||||||||
Synonyms |
|
|||||||||
Gene Name | ZDHHC1 | |||||||||
Protein Type | Unknown | |||||||||
Biological Properties | ||||||||||
General Function | Not Available | |||||||||
Specific Function | Not Available | |||||||||
Pathways | Not Available | |||||||||
Reactions |
|
|||||||||
GO Classification |
|
|||||||||
Cellular Location | Not Available | |||||||||
Gene Properties | ||||||||||
Chromosome Location | 16 | |||||||||
Locus | 16q22.1 | |||||||||
SNPs | Not Available | |||||||||
Gene Sequence | Not Available | |||||||||
Protein Properties | ||||||||||
Number of Residues | Not Available | |||||||||
Molecular Weight | 54817.74 | |||||||||
Theoretical pI | 10.322 | |||||||||
Pfam Domain Function | Not Available | |||||||||
Signals | Not Available | |||||||||
Transmembrane Regions | Not Available | |||||||||
Protein Sequence |
>>gi|24307963|ref|NP_037436.1| probable palmitoyltransferase ZDHHC1 [Homo sapiens] MYKMNICNKPSNKTAPEKSVWTAPAQPSGPSPELQGQRSRRNGWSWPPHPLQIVAWLLYL FFAVIGFGIL |
|||||||||
External Links | ||||||||||
GenBank ID Protein | Not Available | |||||||||
UniProtKB/Swiss-Prot ID | Q8WTX9 | |||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||
PDB IDs | Not Available | |||||||||
GenBank Gene ID | Not Available | |||||||||
GeneCard ID | Not Available | |||||||||
GenAtlas ID | Not Available | |||||||||
HGNC ID | HGNC:17916 | |||||||||
References | ||||||||||
General References | Not Available |