You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Zinc transporter 10 (HMDBP12035)
Identification | ||||||||
---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP12035 | |||||||
Secondary Accession Numbers | None | |||||||
Name | Zinc transporter 10 | |||||||
Synonyms |
|
|||||||
Gene Name | SLC30A10 | |||||||
Protein Type | Unknown | |||||||
Biological Properties | ||||||||
General Function | Not Available | |||||||
Specific Function | May be involved in zinc transport out of the cell, being a zinc-efflux transporter (By similarity). | |||||||
Pathways | Not Available | |||||||
Reactions | Not Available | |||||||
GO Classification |
|
|||||||
Cellular Location | Not Available | |||||||
Gene Properties | ||||||||
Chromosome Location | 1 | |||||||
Locus | 1q41 | |||||||
SNPs | Not Available | |||||||
Gene Sequence | Not Available | |||||||
Protein Properties | ||||||||
Number of Residues | Not Available | |||||||
Molecular Weight | 52683.46 | |||||||
Theoretical pI | 6.724 | |||||||
Pfam Domain Function | Not Available | |||||||
Signals | Not Available | |||||||
Transmembrane Regions | Not Available | |||||||
Protein Sequence |
>>gi|52351208|ref|NP_061183.2| zinc transporter 10 [Homo sapiens] MGRYSGKTCRLLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYI ARRPTRGFSA |
|||||||
External Links | ||||||||
GenBank ID Protein | Not Available | |||||||
UniProtKB/Swiss-Prot ID | Q6XR72 | |||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||
PDB IDs | Not Available | |||||||
GenBank Gene ID | Not Available | |||||||
GeneCard ID | Not Available | |||||||
GenAtlas ID | Not Available | |||||||
HGNC ID | HGNC:25355 | |||||||
References | ||||||||
General References | Not Available |