Showing Protein Zinc transporter 3 (HMDBP12038)
| Identification | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP12038 | ||||||||||||
| Secondary Accession Numbers | None | ||||||||||||
| Name | Zinc transporter 3 | ||||||||||||
| Synonyms |
|
||||||||||||
| Gene Name | SLC30A3 | ||||||||||||
| Protein Type | Unknown | ||||||||||||
| Biological Properties | |||||||||||||
| General Function | Not Available | ||||||||||||
| Specific Function | Involved in accumulation of zinc in synaptic vesicles (By similarity). | ||||||||||||
| Pathways | Not Available | ||||||||||||
| Reactions | Not Available | ||||||||||||
| GO Classification |
|
||||||||||||
| Cellular Location | Not Available | ||||||||||||
| Gene Properties | |||||||||||||
| Chromosome Location | 2 | ||||||||||||
| Locus | 2p23.3 | ||||||||||||
| SNPs | Not Available | ||||||||||||
| Gene Sequence | Not Available | ||||||||||||
| Protein Properties | |||||||||||||
| Number of Residues | Not Available | ||||||||||||
| Molecular Weight | 41944.895 | ||||||||||||
| Theoretical pI | 6.468 | ||||||||||||
| Pfam Domain Function | Not Available | ||||||||||||
| Signals | Not Available | ||||||||||||
| Transmembrane Regions | Not Available | ||||||||||||
| Protein Sequence |
>>gi|21361112|ref|NP_003450.2| zinc transporter 3 [Homo sapiens] MEPSPAAGGLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPL PPPGLTPERL |
||||||||||||
| External Links | |||||||||||||
| GenBank ID Protein | Not Available | ||||||||||||
| UniProtKB/Swiss-Prot ID | Q99726 | ||||||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||
| PDB IDs | Not Available | ||||||||||||
| GenBank Gene ID | Not Available | ||||||||||||
| GeneCard ID | Not Available | ||||||||||||
| GenAtlas ID | Not Available | ||||||||||||
| HGNC ID | HGNC:11014 | ||||||||||||
| References | |||||||||||||
| General References | Not Available | ||||||||||||