Showing Protein Zinc transporter 6 (HMDBP12040)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP12040 | ||||||||
| Secondary Accession Numbers | None | ||||||||
| Name | Zinc transporter 6 | ||||||||
| Synonyms |
|
||||||||
| Gene Name | SLC30A6 | ||||||||
| Protein Type | Unknown | ||||||||
| Biological Properties | |||||||||
| General Function | Not Available | ||||||||
| Specific Function | Zinc-efflux transporter which allocates the cytoplasmic zinc to the trans-Golgi network (TGN) as well as the vesicular compartment (By similarity). | ||||||||
| Pathways | Not Available | ||||||||
| Reactions | Not Available | ||||||||
| GO Classification |
|
||||||||
| Cellular Location | Not Available | ||||||||
| Gene Properties | |||||||||
| Chromosome Location | 2 | ||||||||
| Locus | 2p22.3 | ||||||||
| SNPs | Not Available | ||||||||
| Gene Sequence | Not Available | ||||||||
| Protein Properties | |||||||||
| Number of Residues | Not Available | ||||||||
| Molecular Weight | 55794.35 | ||||||||
| Theoretical pI | 9.063 | ||||||||
| Pfam Domain Function | Not Available | ||||||||
| Signals | Not Available | ||||||||
| Transmembrane Regions | Not Available | ||||||||
| Protein Sequence |
>>gi|301898419|ref|NP_001180442.1| zinc transporter 6 isoform 1 [Homo sapiens] MGTIHLFRKPQRSFFGKLLREFRLVAADRRSWKILLFGVINLICTGFLLMWCSSTNSIAL TAYTYLTIFD |
||||||||
| External Links | |||||||||
| GenBank ID Protein | Not Available | ||||||||
| UniProtKB/Swiss-Prot ID | Q6NXT4 | ||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
| PDB IDs | Not Available | ||||||||
| GenBank Gene ID | Not Available | ||||||||
| GeneCard ID | Not Available | ||||||||
| GenAtlas ID | Not Available | ||||||||
| HGNC ID | HGNC:19305 | ||||||||
| References | |||||||||
| General References | Not Available | ||||||||