Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP12041
Secondary Accession Numbers None
Name Zinc transporter 7
Synonyms
  1. ZnT-7
  2. Solute carrier family 30 member 7
  3. Znt-like transporter 2
Gene Name SLC30A7
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Seems to facilitate zinc transport from the cytoplasm into the Golgi apparatus. Partly regulates cellular zinc homeostasis. Required with ZNT5 for the activation of zinc-requiring enzymes, alkaline phosphatases (ALPs). Transports zinc into the lumens of the Golgi apparatus and the vesicular compartments where ALPs locate, thus, converting apoALPs to holoALPs. Required with ZNT5 and ZNT6 for the activation of TNAP (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
zinc ion transport
sequestering of zinc ion
transmembrane transport
Cellular Component
perinuclear region of cytoplasm
vesicle
integral to membrane
Golgi membrane
cytoplasmic membrane-bounded vesicle
Molecular Function
cation transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p21.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 41625.605
Theoretical pI 6.941
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|222080086|ref|NP_001138356.1| zinc transporter 7 [Homo sapiens]
MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSN
CLGLISDSFH
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8NEW0
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:19306
References
General References Not Available