Showing Protein Zinc transporter 9 (HMDBP12043)
Identification | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP12043 | ||||||||||||
Secondary Accession Numbers | None | ||||||||||||
Name | Zinc transporter 9 | ||||||||||||
Synonyms |
|
||||||||||||
Gene Name | SLC30A9 | ||||||||||||
Protein Type | Unknown | ||||||||||||
Biological Properties | |||||||||||||
General Function | Not Available | ||||||||||||
Specific Function | Plays a role in the p160 coactivator signaling pathway that mediates transcriptional activation by nuclear receptors (By similarity). Plays a role in transcriptional activation of Wnt-responsive genes (By similarity). | ||||||||||||
Pathways | Not Available | ||||||||||||
Reactions | Not Available | ||||||||||||
GO Classification |
|
||||||||||||
Cellular Location | Not Available | ||||||||||||
Gene Properties | |||||||||||||
Chromosome Location | 4 | ||||||||||||
Locus | 4p13 | ||||||||||||
SNPs | Not Available | ||||||||||||
Gene Sequence | Not Available | ||||||||||||
Protein Properties | |||||||||||||
Number of Residues | Not Available | ||||||||||||
Molecular Weight | 63514.525 | ||||||||||||
Theoretical pI | 8.33 | ||||||||||||
Pfam Domain Function | Not Available | ||||||||||||
Signals | Not Available | ||||||||||||
Transmembrane Regions | Not Available | ||||||||||||
Protein Sequence |
>>gi|57164948|ref|NP_006336.3| zinc transporter 9 [Homo sapiens] MLPGLAAAAAHRCSWSSLCRLRLRCRAAACNPSDRQEWQNLVTFGSFSNMVPCSHPYIGT LSQVKLYSTN |
||||||||||||
External Links | |||||||||||||
GenBank ID Protein | Not Available | ||||||||||||
UniProtKB/Swiss-Prot ID | Q6PML9 | ||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||
PDB IDs | |||||||||||||
GenBank Gene ID | Not Available | ||||||||||||
GeneCard ID | Not Available | ||||||||||||
GenAtlas ID | Not Available | ||||||||||||
HGNC ID | HGNC:1329 | ||||||||||||
References | |||||||||||||
General References | Not Available |