| Version |
2.5 |
| Creation Date |
2005-11-16 15:48:42 |
| Update Date |
2010-04-22 10:33:34 |
| Accession Number |
HMDB00896 |
| Secondary Accession Numbers |
HMDB04011 |
| Common Name |
Taurodeoxycholic acid |
| Description |
Taurodeoxycholic acid is a bile salt formed in the liver by conjugation of deoxycholate with taurine, usually as the sodium salt. Bile acids are steroid acids found predominantly in bile of mammals. The distinction between different bile acids is minute, depends only on presence or absence of hydroxyl groups on positions 3, 7, and 12. Bile acids are physiological detergents that facilitate excretion, absorption, and transport of fats and sterols in the intestine and liver. Bile acids are also steroidal amphipathic molecules derived from the catabolism of cholesterol. They modulate bile flow and lipid secretion, are essential for the absorption of dietary fats and vitamins, and have been implicated in the regulation of all the key enzymes involved in cholesterol homeostasis. Bile acids recirculate through the liver, bile ducts, small intestine and portal vein to form an enterohepatic circuit. They exist as anions at physiological pH and, consequently, require a carrier for transport across the membranes of the enterohepatic tissues. The unique detergent properties of bile acids are essential for the digestion and intestinal absorption of hydrophobic nutrients. Bile acids have potent toxic properties (e.g., membrane disruption) and there are a plethora of mechanisms to limit their accumulation in blood and tissues. (PMID: 11316487, 16037564, 12576301, 11907135) |
| Synonyms |
- Deoxycholyltaurine
- Deoxytaurocholate
- Deoxytaurocholic acid
- N-(3a,12a-dihydroxy-5b-cholan-24-oyl)-Taurine
- Sodium taurodeoxycholate
- Sodium taurodeoxylate
- Taurodeoxycholic acid
- Taurodeoxycholic acid sodium salt
- Taurodeoxycholic acid sodium salt hydrate
- Taurodesoxycholate
- Taurodesoxycholic acid
- Tudcabil
|
| Chemical IUPAC Name |
2-[4-[(3R,5R,8R,9S,10S,12S,13R,14S,17R)-3,12-dihydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1H-cyclopenta[a]phenanthren-17-yl]pentanoylamino]ethanesulfonic acid |
| Chemical Formula |
C26H45NO6S |
| Chemical Structure |
 |
| Chemical Taxonomy |
| Kingdom |
|
| Super Class |
- Cholesterols and derivatives
|
| Class |
|
| Sub Class |
|
| Family |
|
| Species |
- secondary alcohol
- secondary carboxylic acid amide
- sulfonic acid
|
| Biofunction |
- Hormones, Membrane component
|
| Application |
| — |
| Source |
|
|
| Average Molecular Weight |
499.704 |
| Monoisotopic Molecular Weight |
499.296753 |
| Isomeric SMILES |
C[C@H](CCC(=O)NCCS(O)(=O)=O)[C@H]1CC[C@H]2[C@@H]3CC[C@@H]4C[C@H](O)CC[C@]4(C)[C@H]3C[C@H](O)[C@]12C |
| Canonical SMILES |
CC(CCC(=O)NCCS(O)(=O)=O)C1CCC2C3CCC4CC(O)CCC4(C)C3CC(O)C12C |
| KEGG Compound ID |
C05463  |
| BioCyc ID |
Not Available |
| BiGG ID |
Not Available |
| Wikipedia Link |
Not Available |
| NuGOwiki Link |
HMDB00896 |
| Metagene Link |
HMDB00896 |
| METLIN ID |
5853 |
| PubChem Compound |
10594 |
| PubChem Substance |
7823 |
| ChEBI ID |
9410 |
| CAS Registry Number |
516-50-7 |
| InChI Identifier |
InChI=1/C26H45NO6S/c1-16(4-9-24(30)27-12-13-34(31,32)33)20-7-8-21-19-6-5-17-14-18(28)10-11-25(17,2)22(19)15-23(29)26(20,21)3/h16-23,28-29H,4-15H2,1-3H3,(H,27,30)(H,31,32,33)/t16-,17-,18-,19+,20-,21+,22+,23+,25+,26-/m1/s1 |
| Synthesis Reference |
Parenti, Massimo. Preparation of tauroursodesoxycholic acid dihydrate. Eur. Pat. Appl. (1990), 3 pp. CODEN: EPXXDW EP 400695 A2 19901205 CAN 114:82269 AN 1991:82269 |
| Melting Point (Experimental) |
204 - 208 oC |
| Experimental Water Solubility |
41 mg/mL [HMP experimental]
Source: PhysProp
|
| Predicted Water Solubility |
7.76e-03 mg/mL [Predicted by ALOGPS]
Calculated using ALOGPS
|
| Physiological Charge |
-1 |
| State |
Solid |
| Experimental LogP/Hydrophobicity |
Not Available
Source: PhysProp
|
| Predicted LogP/Hydrophobicity |
1.19 [Predicted by ALOGPS]; 4.4 [Predicted by PubChem via XLOGP]
Calculated using ALOGPS
|
| Material Safety Data Sheet (MSDS) |
|
| MOL File |
Show |
| SDF File |
Show |
| PDB File |
Show |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Experimental 1H NMR Spectrum |
Download Spectrum
Download FID (Varian)
Show Experimental Conditions |
| Experimental 13C NMR Spectrum |
Not Available |
| Experimental 13C HSQC Spectrum |
Download Spectrum
Download FID (Bruker)
Show Experimental Conditions |
| Predicted 1H NMR Spectrum |
Show Image
Show Peaklist
|
| Predicted 13C NMR Spectrum |
Show Image
Show Peaklist
|
| Mass Spectrum |
|
| Simplified TOCSY Spectrum |
Not Available |
| BMRB Spectrum |
Not Available |
| Cellular Location |
|
| Biofluid Location |
|
| Tissue Location |
| Tissue |
References |
| Intestine |
— |
|
| Concentrations (Normal) |
| Biofluid |
Bile |
| Value |
> 0.01 uM |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Bloch CA, Watkins JB: Determination of conjugated bile acids in human bile and duodenal fluid by reverse-phase high-performance liquid chromatography. J Lipid Res. 1978 May;19(4):510-3. [PubMed ]
|
| Biofluid |
Blood |
| Value |
0.062 (0.000-0.177) uM |
| Age |
Adult:>18 yrs old |
| Sex |
N/A |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Tagliacozzi D, Mozzi AF, Casetta B, Bertucci P, Bernardini S, Di Ilio C, Urbani A, Federici G: Quantitative analysis of bile acids in human plasma by liquid chromatography-electrospray tandem mass spectrometry: a simple and rapid one-step method. Clin Chem Lab Med. 2003 Dec;41(12):1633-41. [PubMed ]
- Bloch CA, Watkins JB: Determination of conjugated bile acids in human bile and duodenal fluid by reverse-phase high-performance liquid chromatography. J Lipid Res. 1978 May;19(4):510-3. [PubMed ]
|
|
| Concentrations (Abnormal) |
Not Available |
| Associated Disorders |
Not Available |
| OMIM ID |
Not Available |
| Pathways |
|
| General References |
- Bloch CA, Watkins JB: Determination of conjugated bile acids in human bile and duodenal fluid by reverse-phase high-performance liquid chromatography. J Lipid Res. 1978 May;19(4):510-3. [PubMed ]
- Foley DP, Collins BR, Magee JC, Platt JL, Katz E, Harland RC, Meyers WC, Chari RS: Bile acids in xenogeneic ex-vivo liver perfusion: function of xenoperfused livers and compatibility with human bile salts and porcine livers. Transplantation. 2000 Jan 27;69(2):242-8. [PubMed ]
- Bretagne JF, Vidon N, L'Hirondel C, Bernier JJ: Increased cell loss in the human jejunum induced by laxatives (ricinoleic acid, dioctyl sodium sulphosuccinate, magnesium sulphate, bile salts). Gut. 1981 Apr;22(4):264-9. [PubMed ]
- Leveau P, Wang X, Sun Z, Borjesson A, Andersson E, Andersson R: Severity of pancreatitis-associated gut barrier dysfunction is reduced following treatment with the PAF inhibitor lexipafant. Biochem Pharmacol. 2005 May 1;69(9):1325-31. [PubMed ]
- Burkard I, von Eckardstein A, Rentsch KM: Differentiated quantification of human bile acids in serum by high-performance liquid chromatography-tandem mass spectrometry. J Chromatogr B Analyt Technol Biomed Life Sci. 2005 Nov 5;826(1-2):147-59. Epub 2005 Sep 22. [PubMed ]
- Lim HJ, Kim SY, Lee WK: Isolation of cholesterol-lowering lactic acid bacteria from human intestine for probiotic use. J Vet Sci. 2004 Dec;5(4):391-5. [PubMed ]
- Muhlbauer M, Allard B, Bosserhoff AK, Kiessling S, Herfarth H, Rogler G, Scholmerich J, Jobin C, Hellerbrand C: Differential effects of deoxycholic acid and taurodeoxycholic acid on NF-kappa B signal transduction and IL-8 gene expression in colonic epithelial cells. Am J Physiol Gastrointest Liver Physiol. 2004 Jun;286(6):G1000-8. Epub 2004 Jan 15. [PubMed ]
- Pouwels MJ, Tack CJ, Span PN, Olthaar AJ, Sweep CG, Huvers FC, Lutterman JA, Hermus AR: Role of hexosamines in insulin resistance and nutrient sensing in human adipose and muscle tissue. J Clin Endocrinol Metab. 2004 Oct;89(10):5132-7. [PubMed ]
- Elkins CA, Mullis LB: Bile-mediated aminoglycoside sensitivity in Lactobacillus species likely results from increased membrane permeability attributable to cholic acid. Appl Environ Microbiol. 2004 Dec;70(12):7200-9. [PubMed ]
- Aubert E, Sbarra V, Le Petit-Thevenin J, Valette A, Lombardo D: Site-directed mutagenesis of the basic N-terminal cluster of pancreatic bile salt-dependent lipase. Functional significance. J Biol Chem. 2002 Sep 20;277(38):34987-96. Epub 2002 Jul 10. [PubMed ]
- Xie Q, Li GM, Zhou XQ, Liao D, Yu H, Guo Q: [Effect of Tauroursodeoxycholic acid on cytochrome C-mediated apoptosis in HepG2 cells] Zhonghua Gan Zang Bing Za Zhi. 2003 May;11(5):298-301. [PubMed ]
|
| Metabolic Enzymes |
- Choloylglycine hydrolase (EC 3.5.1.24)
- Choloylglycine hydrolase (EC 3.5.1.24)
- Choloylglycine hydrolase (EC 3.5.1.24)
- Choloylglycine hydrolase
- Bile salt hydrolase
- Bile salt hydrolase (EC 3.5.1.24)
- Choloylglycine hydrolase
- Putative choloylglycine hydrolase (EC 3.5.1.24)
- Choloylglycine hydrolase
- Choloylglycine hydrolase
- Choloylglycine hydrolase (EC 3.5.1.24)
- Choloylglycine hydrolase family protein
- Choloylglycine hydrolase family protein
- EF0040 (Choloylglycine hydrolase) (Choloylglycine hydrolase family protein)
- Conjugated bile acid hydrolase
|
|
Enzyme 1
[top]
|
| Enzyme 1 ID |
15841 |
| Enzyme 1 Name |
Choloylglycine hydrolase (EC 3.5.1.24) |
| Enzyme 1 Synonyms |
Not Available |
| Enzyme 1 Gene Name |
bsh2 |
| Enzyme 1 Protein Sequence |
>Choloylglycine hydrolase (EC 3.5.1.24)
MCTSLTYTNSHGGHFLARTMDFNVDFETRIMFMPRHYRVTGDLGDFTTTYGFIGAGRQLN
HEIFTDGVNECGVSIAALYFPNHAIYQPHSNQDKIDLAPHDFVAWVLGKITSVADLRERV
KDVQLISSTAELINEIPPLHFIISDQTGETAVLEPTSGELRLLNNPVGVLTNSPNLKWQL
QNLSKYGTLTNTERPLNKFINYQPGSQGPGTGALGLPGDYTSMSRFARTVFLKHYAQVPA
TTTDTVNLLQHILNAVTIPKGAKVAANGQATYTEYRSYMDLNHQTYALELYENPGVIQQV
NLTDHLLEKQTVPLEYVLSRTPHVQLLTPDVATLPAAH
|
| Enzyme 1 Number of Residues |
338 |
| Enzyme 1 Molecular Weight |
37542 |
| Enzyme 1 Theoretical pI |
6.39 |
| Enzyme 1 GO Classification |
Not Available |
| Enzyme 1 General Function |
Cell wall/membrane/envelope biogenesis |
| Enzyme 1 Specific Function |
Not Available |
| Enzyme 1 Pathways |
Not Available |
| Enzyme 1 Reactions |
- 3alpha,7alpha,12alpha-trihydroxy-5beta-cholan-24-oylglycine + H2O = 3alpha,7alpha,12alpha-trihydroxy-5beta-cholanate + glycine [RN:R05835] ALL_REAC R05835
- (other) R02797 R03975 R03977 R04486 R04487
|
| Enzyme 1 Pfam Domain Function |
|
| Enzyme 1 Signals |
|
| Enzyme 1 Transmembrane Regions |
|
| Enzyme 1 Essentiality |
Not Available |
| Enzyme 1 GenBank ID Protein |
Not Available |
| Enzyme 1 UniProtKB/Swiss-Prot ID |
Q890F5 |
| Enzyme 1 UniProtKB/Swiss-Prot Entry Name |
Q890F5_LACPL |
| Enzyme 1 PDB ID |
Not Available |
| Enzyme 1 Cellular Location |
Not Available |
| Enzyme 1 Gene Sequence |
Not Available |
| Enzyme 1 GenBank Gene ID |
AL935252 |
| Enzyme 1 GeneCard ID |
Not Available |
| Enzyme 1 GenAtlas ID |
Not Available |
| Enzyme 1 HGNC ID |
Not Available |
| Enzyme 1 Chromosome Location |
Not Available |
| Enzyme 1 Locus |
Not Available |
| Enzyme 1 SNPs |
SNPJam Report |
| Enzyme 1 General References |
- Kleerebezem M, Boekhorst J, van Kranenburg R, Molenaar D, Kuipers OP, Leer R, Tarchini R, Peters SA, Sandbrink HM, Fiers MW, Stiekema W, Lankhorst RM, Bron PA, Hoffer SM, Groot MN, Kerkhoven R, de Vries M, Ursing B, de Vos WM, Siezen RJ: Complete genome sequence of Lactobacillus plantarum WCFS1. Proc Natl Acad Sci U S A. 2003 Feb 18;100(4):1990-5. Epub 2003 Feb 3. [PubMed ]
|
| Enzyme 1 Metabolite References |
Not Available |
|
Enzyme 2
[top]
|
| Enzyme 2 ID |
15842 |
| Enzyme 2 Name |
Choloylglycine hydrolase (EC 3.5.1.24) |
| Enzyme 2 Synonyms |
Not Available |
| Enzyme 2 Gene Name |
bsh4 |
| Enzyme 2 Protein Sequence |
>Choloylglycine hydrolase (EC 3.5.1.24)
MCTSLTYLDTDNHRYFARTMDFPTTTPWRPIFLPRRYPWPTGLATTRMTQYAILGGGRLP
DHFKACLMADSINEAGLVCAELYLPHAVEYATQSQVNQINLTPQAFINWALGEHQSVAAV
IADLPSVNLVGASWGDDTGEVYPFHWYLSDAHTSAVIEPTGGPLTVQPNPAGVLTNTPVL
SDHQRRLNRYLAVSGNQITTATRQAAQHVIQTKQPLPSGPIPTDRFIHMALRRLGTPQLA
PQQVPTTLFRWLQEVSLPYHADRRHLISHNYTHYRCLITLATRTYRFIPRTTGHEQRLTL
TPEMATTWRTPYLFPAD
|
| Enzyme 2 Number of Residues |
317 |
| Enzyme 2 Molecular Weight |
35767 |
| Enzyme 2 Theoretical pI |
8.59 |
| Enzyme 2 GO Classification |
Not Available |
| Enzyme 2 General Function |
Cell wall/membrane/envelope biogenesis |
| Enzyme 2 Specific Function |
Not Available |
| Enzyme 2 Pathways |
Not Available |
| Enzyme 2 Reactions |
- 3alpha,7alpha,12alpha-trihydroxy-5beta-cholan-24-oylglycine + H2O = 3alpha,7alpha,12alpha-trihydroxy-5beta-cholanate + glycine [RN:R05835] ALL_REAC R05835
- (other) R02797 R03975 R03977 R04486 R04487
|
| Enzyme 2 Pfam Domain Function |
|
| Enzyme 2 Signals |
|
| Enzyme 2 Transmembrane Regions |
|
| Enzyme 2 Essentiality |
Not Available |
| Enzyme 2 GenBank ID Protein |
Not Available |
| Enzyme 2 UniProtKB/Swiss-Prot ID |
Q88UC9 |
| Enzyme 2 UniProtKB/Swiss-Prot Entry Name |
Q88UC9_LACPL |
| Enzyme 2 PDB ID |
Not Available |
| Enzyme 2 Cellular Location |
Not Available |
| Enzyme 2 Gene Sequence |
Not Available |
| Enzyme 2 GenBank Gene ID |
AL935259 |
| Enzyme 2 GeneCard ID |
Not Available |
| Enzyme 2 GenAtlas ID |
Not Available |
| Enzyme 2 HGNC ID |
Not Available |
| Enzyme 2 Chromosome Location |
Not Available |
| Enzyme 2 Locus |
Not Available |
| Enzyme 2 SNPs |
SNPJam Report |
| Enzyme 2 General References |
- Kleerebezem M, Boekhorst J, van Kranenburg R, Molenaar D, Kuipers OP, Leer R, Tarchini R, Peters SA, Sandbrink HM, Fiers MW, Stiekema W, Lankhorst RM, Bron PA, Hoffer SM, Groot MN, Kerkhoven R, de Vries M, Ursing B, de Vos WM, Siezen RJ: Complete genome sequence of Lactobacillus plantarum WCFS1. Proc Natl Acad Sci U S A. 2003 Feb 18;100(4):1990-5. Epub 2003 Feb 3. [PubMed ]
|
| Enzyme 2 Metabolite References |
Not Available |
|
Enzyme 3
[top]
|
| Enzyme 3 ID |
15843 |
| Enzyme 3 Name |
Choloylglycine hydrolase (EC 3.5.1.24) |
| Enzyme 3 Synonyms |
Not Available |
| Enzyme 3 Gene Name |
bsh3 |
| Enzyme 3 Protein Sequence |
>Choloylglycine hydrolase (EC 3.5.1.24)
MCTSLTIQTTAGDQFLARTMDFAFELGGRPVAIPRNHHFDSVTNADGFDSPYSFVGTGRD
LNGYIFVDGVNEHGVSAAALYFSGQAHFTQQTKAGKVNLAPHEVLMWILGNVKSTAELGE
RIADLNVMEAAAPLLNIVVPLHWIISDKSGSTYVLELENDGVHYMKNPVGVMTNTPDFEW
HLKNLSNYVNLQPGPHPSRQYGDMTVNPFGPGTGALGMPGDYTSVARFVRTVFMREHTDA
VTTDAEAVNALSHMLNSVEIPKGVKMQDNGTPDYTQYRAYMSMNEPAFYMQPYADQTITR
VELTPALMTAAQPTEFELKTTQQFRLAN
|
| Enzyme 3 Number of Residues |
328 |
| Enzyme 3 Molecular Weight |
36167 |
| Enzyme 3 Theoretical pI |
5.12 |
| Enzyme 3 GO Classification |
Not Available |
| Enzyme 3 General Function |
Cell wall/membrane/envelope biogenesis |
| Enzyme 3 Specific Function |
Not Available |
| Enzyme 3 Pathways |
Not Available |
| Enzyme 3 Reactions |
- 3alpha,7alpha,12alpha-trihydroxy-5beta-cholan-24-oylglycine + H2O = 3alpha,7alpha,12alpha-trihydroxy-5beta-cholanate + glycine [RN:R05835] ALL_REAC R05835
- (other) R02797 R03975 R03977 R04486 R04487
|
| Enzyme 3 Pfam Domain Function |
|
| Enzyme 3 Signals |
|
| Enzyme 3 Transmembrane Regions |
|
| Enzyme 3 Essentiality |
Not Available |
| Enzyme 3 GenBank ID Protein |
Not Available |
| Enzyme 3 UniProtKB/Swiss-Prot ID |
Q88SP0 |
| Enzyme 3 UniProtKB/Swiss-Prot Entry Name |
Q88SP0_LACPL |
| Enzyme 3 PDB ID |
Not Available |
| Enzyme 3 Cellular Location |
Not Available |
| Enzyme 3 Gene Sequence |
Not Available |
| Enzyme 3 GenBank Gene ID |
AL935261 |
| Enzyme 3 GeneCard ID |
Not Available |
| Enzyme 3 GenAtlas ID |
Not Available |
| Enzyme 3 HGNC ID |
Not Available |
| Enzyme 3 Chromosome Location |
Not Available |
| Enzyme 3 Locus |
Not Available |
| Enzyme 3 SNPs |
SNPJam Report |
| Enzyme 3 General References |
- Kleerebezem M, Boekhorst J, van Kranenburg R, Molenaar D, Kuipers OP, Leer R, Tarchini R, Peters SA, Sandbrink HM, Fiers MW, Stiekema W, Lankhorst RM, Bron PA, Hoffer SM, Groot MN, Kerkhoven R, de Vries M, Ursing B, de Vos WM, Siezen RJ: Complete genome sequence of Lactobacillus plantarum WCFS1. Proc Natl Acad Sci U S A. 2003 Feb 18;100(4):1990-5. Epub 2003 Feb 3. [PubMed ]
|
| Enzyme 3 Metabolite References |
Not Available |
|
Enzyme 4
[top]
|
| Enzyme 4 ID |
15844 |
| Enzyme 4 Name |
Choloylglycine hydrolase |
| Enzyme 4 Synonyms |
- Conjugated bile acid hydrolase
- CBAH
- Bile salt hydrolase
|
| Enzyme 4 Gene Name |
cbh |
| Enzyme 4 Protein Sequence |
>Choloylglycine hydrolase
MCTAITYQSYNNYFGRNFDYEISYNEMVTITPRKYPLVFRKVENLDHHYAIIGITADVES
YPLYYDAMNEKGLCIAGLNFAGYADYKKYDADKVNITPFELIPWLLGQFSSVREVKKNIQ
KLNLVNINFSEQLPLSPLHWLVADKQESIVIESVKEGLKIYDNPVGVLTNNPNFDYQLFN
LNNYRALSNSTPQNSFSEKVDLDSYSRGMGGLGLPGDLSSMSRFVRAAFTKLNSLSMQTE
SGSVSQFFHILGSVEQQKGLCEVTDGKYEYTIYSSCCDMDKGVYYYRTYDNSQINSVSLN
HEHLDTTELISYPLRSEAQYYAVN
|
| Enzyme 4 Number of Residues |
324 |
| Enzyme 4 Molecular Weight |
37042 |
| Enzyme 4 Theoretical pI |
4.92 |
| Enzyme 4 GO Classification |
Not Available |
| Enzyme 4 General Function |
Cell wall/membrane/envelope biogenesis |
| Enzyme 4 Specific Function |
The enzyme catalyzes the degradation of conjugated bile acids in the mammalian gut |
| Enzyme 4 Pathways |
Not Available |
| Enzyme 4 Reactions |
Not Available |
| Enzyme 4 Pfam Domain Function |
|
| Enzyme 4 Signals |
|
| Enzyme 4 Transmembrane Regions |
|
| Enzyme 4 Essentiality |
Not Available |
| Enzyme 4 GenBank ID Protein |
Not Available |
| Enzyme 4 UniProtKB/Swiss-Prot ID |
Q06115 |
| Enzyme 4 UniProtKB/Swiss-Prot Entry Name |
CBH_LACPL |
| Enzyme 4 PDB ID |
Not Available |
| Enzyme 4 Cellular Location |
Not Available |
| Enzyme 4 Gene Sequence |
Not Available |
| Enzyme 4 GenBank Gene ID |
S51638 |
| Enzyme 4 GeneCard ID |
Not Available |
| Enzyme 4 GenAtlas ID |
Not Available |
| Enzyme 4 HGNC ID |
Not Available |
| Enzyme 4 Chromosome Location |
Not Available |
| Enzyme 4 Locus |
Not Available |
| Enzyme 4 SNPs |
SNPJam Report |
| Enzyme 4 General References |
- Christiaens H, Leer RJ, Pouwels PH, Verstraete W: Cloning and expression of a conjugated bile acid hydrolase gene from Lactobacillus plantarum by using a direct plate assay. Appl Environ Microbiol. 1992 Dec;58(12):3792-8. [PubMed ]
- Kleerebezem M, Boekhorst J, van Kranenburg R, Molenaar D, Kuipers OP, Leer R, Tarchini R, Peters SA, Sandbrink HM, Fiers MW, Stiekema W, Lankhorst RM, Bron PA, Hoffer SM, Groot MN, Kerkhoven R, de Vries M, Ursing B, de Vos WM, Siezen RJ: Complete genome sequence of Lactobacillus plantarum WCFS1. Proc Natl Acad Sci U S A. 2003 Feb 18;100(4):1990-5. Epub 2003 Feb 3. [PubMed ]
|
| Enzyme 4 Metabolite References |
Not Available |
|
Enzyme 5
[top]
|
| Enzyme 5 ID |
15845 |
| Enzyme 5 Name |
Bile salt hydrolase |
| Enzyme 5 Synonyms |
Not Available |
| Enzyme 5 Gene Name |
bshA |
| Enzyme 5 Protein Sequence |
>Bile salt hydrolase
MCTSIIFSPKDHYFGRNLDLEITFGQQVVITPRNYTFKFRKMPSLKKHYAMIGISLDMDD
YPLYFDATNEKGLGMAGLNYPGNATYYEEKENKDNIASFEFIPWILGQCSTISEVKDLLS
RINIADLNFSEKMQASSLHWLIADKTGTSLVVETDKDGMHIYDNPVGCLTNNPQFPKQLF
NLNNYADVSPKMPKNNFSDKVNMAGYSRGLGSHNLPGGMDSESRFVRVAFNKFNAPIAET
EEENIDTYFHILHSVEQQKGLDEVGPNSFEYTIYSDGTNLDKGIFYYTTYSNKQINVVDM
NKEDLDSSNLITYDMLDKTKFNHQN
|
| Enzyme 5 Number of Residues |
325 |
| Enzyme 5 Molecular Weight |
37081 |
| Enzyme 5 Theoretical pI |
4.86 |
| Enzyme 5 GO Classification |
Not Available |
| Enzyme 5 General Function |
Cell wall/membrane/envelope biogenesis |
| Enzyme 5 Specific Function |
Not Available |
| Enzyme 5 Pathways |
Not Available |
| Enzyme 5 Reactions |
Not Available |
| Enzyme 5 Pfam Domain Function |
|
| Enzyme 5 Signals |
|
| Enzyme 5 Transmembrane Regions |
|
| Enzyme 5 Essentiality |
Not Available |
| Enzyme 5 GenBank ID Protein |
Not Available |
| Enzyme 5 UniProtKB/Swiss-Prot ID |
Q5FKM3 |
| Enzyme 5 UniProtKB/Swiss-Prot Entry Name |
Q5FKM3_LACAC |
| Enzyme 5 PDB ID |
Not Available |
| Enzyme 5 Cellular Location |
Not Available |
| Enzyme 5 Gene Sequence |
Not Available |
| Enzyme 5 GenBank Gene ID |
CP000033 |
| Enzyme 5 GeneCard ID |
Not Available |
| Enzyme 5 GenAtlas ID |
Not Available |
| Enzyme 5 HGNC ID |
Not Available |
| Enzyme 5 Chromosome Location |
Not Available |
| Enzyme 5 Locus |
Not Available |
| Enzyme 5 SNPs |
SNPJam Report |
| Enzyme 5 General References |
Not Available |
| Enzyme 5 Metabolite References |
Not Available |
|
Enzyme 6
[top]
|
| Enzyme 6 ID |
15846 |
| Enzyme 6 Name |
Bile salt hydrolase (EC 3.5.1.24) |
| Enzyme 6 Synonyms |
Not Available |
| Enzyme 6 Gene Name |
bshB |
| Enzyme 6 Protein Sequence |
>Bile salt hydrolase (EC 3.5.1.24)
MCTSICYNPNDHYFGRNLDYEIAYGQKVVIVPRNYEFKYREMPSQKMHYAFIGVSVVNDD
YPLLCDAINEKGLGIAGLNFQGPNHYFPKIEGKKNIASFELMPYLLSNCENTDDVKEILD
NANILNISFSANYPAADLHWILSDKAGKSIVVESTNSGLHIYDNPVNVLTNNPEFPDQLI
KLSDYADVTPHNPKNTLVPNVDLNLYSRGLGTHHLPGGMDSSSRFVKVAFVLAHTPQGKN
EVENVTNYFHILHSVEQPDGLDEVEDNRYEYTMYTDCMNLDKGILYFTTYDNNRINAVDM
HKADLDSEDLICYDLFKKQDIEYMN
|
| Enzyme 6 Number of Residues |
325 |
| Enzyme 6 Molecular Weight |
37057 |
| Enzyme 6 Theoretical pI |
4.60 |
| Enzyme 6 GO Classification |
Not Available |
| Enzyme 6 General Function |
Cell wall/membrane/envelope biogenesis |
| Enzyme 6 Specific Function |
Not Available |
| Enzyme 6 Pathways |
Not Available |
| Enzyme 6 Reactions |
- 3alpha,7alpha,12alpha-trihydroxy-5beta-cholan-24-oylglycine + H2O = 3alpha,7alpha,12alpha-trihydroxy-5beta-cholanate + glycine [RN:R05835] ALL_REAC R05835
- (other) R02797 R03975 R03977 R04486 R04487
|
| Enzyme 6 Pfam Domain Function |
|
| Enzyme 6 Signals |
|
| Enzyme 6 Transmembrane Regions |
|
| Enzyme 6 Essentiality |
Not Available |
| Enzyme 6 GenBank ID Protein |
Not Available |
| Enzyme 6 UniProtKB/Swiss-Prot ID |
Q5FK51 |
| Enzyme 6 UniProtKB/Swiss-Prot Entry Name |
Q5FK51_LACAC |
| Enzyme 6 PDB ID |
Not Available |
| Enzyme 6 Cellular Location |
Not Available |
| Enzyme 6 Gene Sequence |
Not Available |
| Enzyme 6 GenBank Gene ID |
CP000033 |
| Enzyme 6 GeneCard ID |
Not Available |
| Enzyme 6 GenAtlas ID |
Not Available |
| Enzyme 6 HGNC ID |
Not Available |
| Enzyme 6 Chromosome Location |
Not Available |
| Enzyme 6 Locus |
Not Available |
| Enzyme 6 SNPs |
SNPJam Report |
| Enzyme 6 General References |
Not Available |
| Enzyme 6 Metabolite References |
Not Available |
|
Enzyme 7
[top]
|
| Enzyme 7 ID |
15847 |
| Enzyme 7 Name |
Choloylglycine hydrolase |
| Enzyme 7 Synonyms |
Not Available |
| Enzyme 7 Gene Name |
Not Available |
| Enzyme 7 Protein Sequence |
>Choloylglycine hydrolase
MCTGVRFSDDEGNTYFGRNLDWSFSYGETILVTPRGYHYDTVFGAGGKAKPNAVIGVGVV
MADRPMYFDCANEHGLAIAGLNFPGYASFVHEPVEGTENVATFEFPLWVARNFDSVDEVE
EALRNVTLVSQIVPGQQESLLHWFIGDGKRSIVVEQMADGMHVHHDDVDVLTNQPTFDFH
MENLRNYMCVSNEMAEPTSWGKASLTAWGAGVGMHGIPGDVSSPSRFVRVAYTNAHYPQQ
NDEAANVSRLFHTLGSVQMVDGMAKMGDGQFERTLFTSGYSSKTNTYYMNTYDDPAIRSY
AMADYDMDSSELISVAR
|
| Enzyme 7 Number of Residues |
317 |
| Enzyme 7 Molecular Weight |
35125 |
| Enzyme 7 Theoretical pI |
4.49 |
| Enzyme 7 GO Classification |
Not Available |
| Enzyme 7 General Function |
Cell wall/membrane/envelope biogenesis |
| Enzyme 7 Specific Function |
Not Available |
| Enzyme 7 Pathways |
Not Available |
| Enzyme 7 Reactions |
Not Available |
| Enzyme 7 Pfam Domain Function |
|
| Enzyme 7 Signals |
|
| Enzyme 7 Transmembrane Regions |
|
| Enzyme 7 Essentiality |
Not Available |
| Enzyme 7 GenBank ID Protein |
Not Available |
| Enzyme 7 UniProtKB/Swiss-Prot ID |
Q8G653 |
| Enzyme 7 UniProtKB/Swiss-Prot Entry Name |
Q8G653_BIFLO |
| Enzyme 7 PDB ID |
Not Available |
| Enzyme 7 Cellular Location |
Not Available |
| Enzyme 7 Gene Sequence |
Not Available |
| Enzyme 7 GenBank Gene ID |
AE014295 |
| Enzyme 7 GeneCard ID |
Not Available |
| Enzyme 7 GenAtlas ID |
Not Available |
| Enzyme 7 HGNC ID |
Not Available |
| Enzyme 7 Chromosome Location |
Not Available |
| Enzyme 7 Locus |
Not Available |
| Enzyme 7 SNPs |
Not Available |
| Enzyme 7 General References |
- Schell MA, Karmirantzou M, Snel B, Vilanova D, Berger B, Pessi G, Zwahlen MC, Desiere F, Bork P, Delley M, Pridmore RD, Arigoni F: The genome sequence of Bifidobacterium longum reflects its adaptation to the human gastrointestinal tract. Proc Natl Acad Sci U S A. 2002 Oct 29;99(22):14422-7. Epub 2002 Oct 15. [PubMed ]
|
| Enzyme 7 Metabolite References |
Not Available |
|
Enzyme 8
[top]
|
| Enzyme 8 ID |
15848 |
| Enzyme 8 Name |
Putative choloylglycine hydrolase (EC 3.5.1.24) |
| Enzyme 8 Synonyms |
Not Available |
| Enzyme 8 Gene Name |
cbh |
| Enzyme 8 Protein Sequence |
>Putative choloylglycine hydrolase (EC 3.5.1.24)
MKSKDGATVVARTIEWAESVMNCMYVVVPRAQELQSLTPSGMDGLKFRAKHGFVGLAVEQ
KEFVVEGMNEKGLSAGLYYFPNYGRYPVYDAAQRDKSLADFQLVSYVLAECSTVDEVKEA
LSQVRVINIDPRSSTVHWRFTEASGRQVVLEIVNEMMNFYDNPLGVLTNSPGLEWHWTNL
NNYINLQPGTLPEHNFGPLEPKSFGHGSGLLGLPGDFTPPSRFVRATFFQLTAPQQPDAK
GSVFQAFHILNNFDIPTGSEQPWGKASANVPSATQFTVACDIRDQKVYYRTMYNSNIRCI
DLKTINFDNVKYQADPLDETKEQPVEMKVIK
|
| Enzyme 8 Number of Residues |
331 |
| Enzyme 8 Molecular Weight |
37168 |
| Enzyme 8 Theoretical pI |
5.68 |
| Enzyme 8 GO Classification |
Not Available |
| Enzyme 8 General Function |
Cell wall/membrane/envelope biogenesis |
| Enzyme 8 Specific Function |
Not Available |
| Enzyme 8 Pathways |
Not Available |
| Enzyme 8 Reactions |
- 3alpha,7alpha,12alpha-trihydroxy-5beta-cholan-24-oylglycine + H2O = 3alpha,7alpha,12alpha-trihydroxy-5beta-cholanate + glycine [RN:R05835] ALL_REAC R05835
- (other) R02797 R03975 R03977 R04486 R04487
|
| Enzyme 8 Pfam Domain Function |
|
| Enzyme 8 Signals |
|
| Enzyme 8 Transmembrane Regions |
|
| Enzyme 8 Essentiality |
Not Available |
| Enzyme 8 GenBank ID Protein |
Not Available |
| Enzyme 8 UniProtKB/Swiss-Prot ID |
Q5LF84 |
| Enzyme 8 UniProtKB/Swiss-Prot Entry Name |
Q5LF84_BACFN |
| Enzyme 8 PDB ID |
Not Available |
| Enzyme 8 Cellular Location |
Not Available |
| Enzyme 8 Gene Sequence |
Not Available |
| Enzyme 8 GenBank Gene ID |
CR626927 |
| Enzyme 8 GeneCard ID |
Not Available |
| Enzyme 8 GenAtlas ID |
Not Available |
| Enzyme 8 HGNC ID |
Not Available |
| Enzyme 8 Chromosome Location |
Not Available |
| Enzyme 8 Locus |
Not Available |
| Enzyme 8 SNPs |
SNPJam Report |
| Enzyme 8 General References |
Not Available |
| Enzyme 8 Metabolite References |
Not Available |
|
Enzyme 9
[top]
|
| Enzyme 9 ID |
15849 |
| Enzyme 9 Name |
Choloylglycine hydrolase |
| Enzyme 9 Synonyms |
Not Available |
| Enzyme 9 Gene Name |
Not Available |
| Enzyme 9 Protein Sequence |
>Choloylglycine hydrolase
MRRKIMMATLIVIAVNFIWSGQPVKACTRAVYIGPDNMVITGRTMDWKEDIQSNLYLFPR
GIKRAGYNKGNTVEWISKYGSIVATGYDIGTCDGMNEKGLVASLLFLPESIYVRRNDTRP
VMGISIWTQYVLDNFATVSEAVEELKKQTFRIDAPDMPNGSASTLHMAITDETGNSAVLE
YIDGNLIIHEGKEYQVMTNSPRYDLQLAVNDYWKEVGGLNMLPGTNRSSDRFVRASFYIH
AIPQTSDAKIAVPSVLSVMRNVSVPFGITTPDKPYISSTRWRSVSDQKNRVYYFESTLTP
NLFWIDLHKVDFSPNASIKKLSLTHGEVYAGDVVKDFKDSRSFTFMFELPK
|
| Enzyme 9 Number of Residues |
351 |
| Enzyme 9 Molecular Weight |
39630 |
| Enzyme 9 Theoretical pI |
8.54 |
| Enzyme 9 GO Classification |
Not Available |
| Enzyme 9 General Function |
Cell wall/membrane/envelope biogenesis |
| Enzyme 9 Specific Function |
Not Available |
| Enzyme 9 Pathways |
Not Available |
| Enzyme 9 Reactions |
Not Available |
| Enzyme 9 Pfam Domain Function |
|
| Enzyme 9 Signals |
|
| Enzyme 9 Transmembrane Regions |
|
| Enzyme 9 Essentiality |
Not Available |
| Enzyme 9 GenBank ID Protein |
Not Available |
| Enzyme 9 UniProtKB/Swiss-Prot ID |
Q64PP5 |
| Enzyme 9 UniProtKB/Swiss-Prot Entry Name |
Q64PP5_BACFR |
| Enzyme 9 PDB ID |
Not Available |
| Enzyme 9 Cellular Location |
Not Available |
| Enzyme 9 Gene Sequence |
Not Available |
| Enzyme 9 GenBank Gene ID |
AP006841 |
| Enzyme 9 GeneCard ID |
Not Available |
| Enzyme 9 GenAtlas ID |
Not Available |
| Enzyme 9 HGNC ID |
Not Available |
| Enzyme 9 Chromosome Location |
Not Available |
| Enzyme 9 Locus |
Not Available |
| Enzyme 9 SNPs |
Not Available |
| Enzyme 9 General References |
Not Available |
| Enzyme 9 Metabolite References |
Not Available |
|
Enzyme 10
[top]
|
| Enzyme 10 ID |
15850 |
| Enzyme 10 Name |
Choloylglycine hydrolase |
| Enzyme 10 Synonyms |
- Conjugated bile acid hydrolase
- CBAH
- Bile salt hydrolase
|
| Enzyme 10 Gene Name |
cbh |
| Enzyme 10 Protein Sequence |
>Choloylglycine hydrolase
MCTGLALETKDGLHLFGRNMDIEYSFNQSIIFIPRNFKCVNKSNKKELTTKYAVLGMGTI
FDDYPTFADGMNEKGLGCAGLNFPVYVSYSKEDIEGKTNIPVYNFLLWVLANFSSVEEVK
EALKNANIVDIPISENIPNTTLHWMISDITGKSIVVEQTKEKLNVFDNNIGVLTNSPTFD
WHVANLNQYVGLRYNQVPEFKLGDQSLTALGQGTGLVGLPGDFTPASRFIRVAFLRDAMI
KNDKDSIDLIEFFHILNNVAMVRGSTRTVEEKSDLTQYTSCMCLEKGIYYYNTYENNQIN
AIDMNKENLDGNEIKTYKYNKTLSINHVN
|
| Enzyme 10 Number of Residues |
329 |
| Enzyme 10 Molecular Weight |
37186 |
| Enzyme 10 Theoretical pI |
5.07 |
| Enzyme 10 GO Classification |
Not Available |
| Enzyme 10 General Function |
Cell wall/membrane/envelope biogenesis |
| Enzyme 10 Specific Function |
The enzyme catalyzes the degradation of conjugated bile acids in the mammalian gut |
| Enzyme 10 Pathways |
Not Available |
| Enzyme 10 Reactions |
Not Available |
| Enzyme 10 Pfam Domain Function |
|
| Enzyme 10 Signals |
|
| Enzyme 10 Transmembrane Regions |
|
| Enzyme 10 Essentiality |
Not Available |
| Enzyme 10 GenBank ID Protein |
Not Available |
| Enzyme 10 UniProtKB/Swiss-Prot ID |
P54965 |
| Enzyme 10 UniProtKB/Swiss-Prot Entry Name |
CBH_CLOPE |
| Enzyme 10 PDB ID |
2BJF |
| Enzyme 10 PDB File |
Show |
| Enzyme 10 3D Structure |
|
| Enzyme 10 Cellular Location |
Not Available |
| Enzyme 10 Gene Sequence |
Not Available |
| Enzyme 10 GenBank Gene ID |
U20191 |
| Enzyme 10 GeneCard ID |
Not Available |
| Enzyme 10 GenAtlas ID |
Not Available |
| Enzyme 10 HGNC ID |
Not Available |
| Enzyme 10 Chromosome Location |
Not Available |
| Enzyme 10 Locus |
Not Available |
| Enzyme 10 SNPs |
SNPJam Report |
| Enzyme 10 General References |
- Coleman JP, Hudson LL: Cloning and characterization of a conjugated bile acid hydrolase gene from Clostridium perfringens. Appl Environ Microbiol. 1995 Jul;61(7):2514-20. [PubMed ]
- Shimizu T, Ohtani K, Hirakawa H, Ohshima K, Yamashita A, Shiba T, Ogasawara N, Hattori M, Kuhara S, Hayashi H: Complete genome sequence of Clostridium perfringens, an anaerobic flesh-eater. Proc Natl Acad Sci U S A. 2002 Jan 22;99(2):996-1001. Epub 2002 Jan 15. [PubMed ]
|
| Enzyme 10 Metabolite References |
Not Available |
|
Enzyme 11
[top]
|
| Enzyme 11 ID |
15851 |
| Enzyme 11 Name |
Choloylglycine hydrolase (EC 3.5.1.24) |
| Enzyme 11 Synonyms |
Not Available |
| Enzyme 11 Gene Name |
Not Available |
| Enzyme 11 Protein Sequence |
>Choloylglycine hydrolase (EC 3.5.1.24)
MCTGLALETKDGLHLFGRNMDIEYSFNQSIIFIPRNFKCVNKSNKKELTTKYAVLGMGTI
FDDYPTFADGMNEKGLGCAGLNFPVYVSYSKEDIEGKTNIPVYNFLLWVLANFSSVEEVK
EALKNANIVDIPISENIPNTTLHWMISDITGKSIVVEQTKEKLNVFDNNIGVLTNSPTFD
WHVANLNQYVGLRYNQVPEFKLGDQSLTALGQGTGLVGLPGDFTPASRFIRVAFLRDAMI
KNDKDSIDLIEFFHILNNVAMVRGSTRTVEEKSDLTQYTSCMCLEKGIYYYNTYENNQIN
AIDMNKENLDGNEIKTYKYNKTLSINHVN
|
| Enzyme 11 Number of Residues |
329 |
| Enzyme 11 Molecular Weight |
37186 |
| Enzyme 11 Theoretical pI |
5.07 |
| Enzyme 11 GO Classification |
| Function |
- DNA binding
- binding
- nucleic acid binding
|
| Process |
- cell organization and biogenesis
- cellular physiological process
- cellular protein metabolism
- chromosome organization and biogenesis
- chromosome organization and biogenesis (sensu Eukaryota)
- macromolecule metabolism
- metabolism
- nucleosome assembly
- organelle organization and biogenesis
- physiological process
- protein complex assembly
- protein metabolism
|
| Component |
- intracellular membrane-bound organelle
- membrane-bound organelle
- nucleosome
- nucleus
- organelle
- protein complex
|
|
| Enzyme 11 General Function |
Cell wall/membrane/envelope biogenesis |
| Enzyme 11 Specific Function |
Not Available |
| Enzyme 11 Pathways |
Not Available |
| Enzyme 11 Reactions |
- 3alpha,7alpha,12alpha-trihydroxy-5beta-cholan-24-oylglycine + H2O = 3alpha,7alpha,12alpha-trihydroxy-5beta-cholanate + glycine [RN:R05835] ALL_REAC R05835
- (other) R02797 R03975 R03977 R04486 R04487
|
| Enzyme 11 Pfam Domain Function |
|
| Enzyme 11 Signals |
|
| Enzyme 11 Transmembrane Regions |
|
| Enzyme 11 Essentiality |
Not Available |
| Enzyme 11 GenBank ID Protein |
Not Available |
| Enzyme 11 UniProtKB/Swiss-Prot ID |
Q0TT83 |
| Enzyme 11 UniProtKB/Swiss-Prot Entry Name |
Q0TT83_CLOP1 |
| Enzyme 11 PDB ID |
2BJF |
| Enzyme 11 PDB File |
Show |
| Enzyme 11 3D Structure |
|
| Enzyme 11 Cellular Location |
Not Available |
| Enzyme 11 Gene Sequence |
Not Available |
| Enzyme 11 GenBank Gene ID |
CP000246 |
| Enzyme 11 GeneCard ID |
Not Available |
| Enzyme 11 GenAtlas ID |
Not Available |
| Enzyme 11 HGNC ID |
Not Available |
| Enzyme 11 Chromosome Location |
Not Available |
| Enzyme 11 Locus |
Not Available |
| Enzyme 11 SNPs |
Not Available |
| Enzyme 11 General References |
Not Available |
| Enzyme 11 Metabolite References |
Not Available |
|
Enzyme 12
[top]
|
| Enzyme 12 ID |
15852 |
| Enzyme 12 Name |
Choloylglycine hydrolase family protein |
| Enzyme 12 Synonyms |
Not Available |
| Enzyme 12 Gene Name |
Not Available |
| Enzyme 12 Protein Sequence |
>Choloylglycine hydrolase family protein
MCTHIHISSVNNNLYWGRTLDTSFNPFEVGSKITIVPRNFTLETQSKPWKTKYAFLGINL
CGSTLFFDGVNEKGLAGGLLFLKACTWDKKENIEKQGLIAINSGEIVTWILSNFESVSDI
KNNISKVVVTSDDIPSLGELGKGNPITAHYTFTDKMGESVVLEPTNHGHFRVFDNTVGVM
ANDPTFDWHMTNLANYLQVQGFNKQQNHLNSKTVITPISNGTGLLGLPGDYTSPSRFVRV
AYLRNLIGDITDEEAPARLFSILNSVWVPKDVERFYEDKKESDFSSYMCAYDQSLGKLYL
RVFNDIDTKEFSLENVKENELVTYSI
|
| Enzyme 12 Number of Residues |
326 |
| Enzyme 12 Molecular Weight |
36672 |
| Enzyme 12 Theoretical pI |
5.40 |
| Enzyme 12 GO Classification |
Not Available |
| Enzyme 12 General Function |
Cell wall/membrane/envelope biogenesis |
| Enzyme 12 Specific Function |
Not Available |
| Enzyme 12 Pathways |
Not Available |
| Enzyme 12 Reactions |
Not Available |
| Enzyme 12 Pfam Domain Function |
|
| Enzyme 12 Signals |
|
| Enzyme 12 Transmembrane Regions |
|
| Enzyme 12 Essentiality |
Not Available |
| Enzyme 12 GenBank ID Protein |
Not Available |
| Enzyme 12 UniProtKB/Swiss-Prot ID |
Q0TRE6 |
| Enzyme 12 UniProtKB/Swiss-Prot Entry Name |
Q0TRE6_CLOP1 |
| Enzyme 12 PDB ID |
Not Available |
| Enzyme 12 Cellular Location |
Not Available |
| Enzyme 12 Gene Sequence |
Not Available |
| Enzyme 12 GenBank Gene ID |
CP000246 |
| Enzyme 12 GeneCard ID |
Not Available |
| Enzyme 12 GenAtlas ID |
Not Available |
| Enzyme 12 HGNC ID |
Not Available |
| Enzyme 12 Chromosome Location |
Not Available |
| Enzyme 12 Locus |
Not Available |
| Enzyme 12 SNPs |
Not Available |
| Enzyme 12 General References |
Not Available |
| Enzyme 12 Metabolite References |
Not Available |
|
Enzyme 13
[top]
|
| Enzyme 13 ID |
15853 |
| Enzyme 13 Name |
Choloylglycine hydrolase family protein |
| Enzyme 13 Synonyms |
Not Available |
| Enzyme 13 Gene Name |
Not Available |
| Enzyme 13 Protein Sequence |
>Choloylglycine hydrolase family protein
MCTHIHISSVNNNLYWGRTLDTSFNPFEVGSKITIVPRNFTLQTESNPWKTKYSFLGINL
CGSTLFFDGVNEKGLAGGLLFLKACTWDKKENIEKQGLTAINSGEIVPWILSNFESVSDI
KNNISKVVVTPDDIPSLGELGKGNPITAHYTFTDKMGESVVLEPTDHGHFRVFDNNVGVM
ANDPTFDWHMTNLANYLQVQGFNKQQNHLNSKTVITPISNGTGLLGLPGDYTSPSRFVRV
AYLRNLIGDVTDEEAPARLFSILNSVWVPKDVERFYEDKKESDFSSYMCAYDQKLGKLYL
RVFNDIDTKEFSLENVKENELVTYSI
|
| Enzyme 13 Number of Residues |
326 |
| Enzyme 13 Molecular Weight |
36709 |
| Enzyme 13 Theoretical pI |
5.21 |
| Enzyme 13 GO Classification |
Not Available |
| Enzyme 13 General Function |
Cell wall/membrane/envelope biogenesis |
| Enzyme 13 Specific Function |
Not Available |
| Enzyme 13 Pathways |
Not Available |
| Enzyme 13 Reactions |
Not Available |
| Enzyme 13 Pfam Domain Function |
|
| Enzyme 13 Signals |
|
| Enzyme 13 Transmembrane Regions |
|
| Enzyme 13 Essentiality |
Not Available |
| Enzyme 13 GenBank ID Protein |
Not Available |
| Enzyme 13 UniProtKB/Swiss-Prot ID |
Q0STT0 |
| Enzyme 13 UniProtKB/Swiss-Prot Entry Name |
Q0STT0_CLOPS |
| Enzyme 13 PDB ID |
Not Available |
| Enzyme 13 Cellular Location |
Not Available |
| Enzyme 13 Gene Sequence |
Not Available |
| Enzyme 13 GenBank Gene ID |
CP000312 |
| Enzyme 13 GeneCard ID |
Not Available |
| Enzyme 13 GenAtlas ID |
Not Available |
| Enzyme 13 HGNC ID |
Not Available |
| Enzyme 13 Chromosome Location |
Not Available |
| Enzyme 13 Locus |
Not Available |
| Enzyme 13 SNPs |
Not Available |
| Enzyme 13 General References |
Not Available |
| Enzyme 13 Metabolite References |
Not Available |
|
Enzyme 14
[top]
|
| Enzyme 14 ID |
15854 |
| Enzyme 14 Name |
EF0040 (Choloylglycine hydrolase) (Choloylglycine hydrolase family protein) |
| Enzyme 14 Synonyms |
Not Available |
| Enzyme 14 Gene Name |
ef0040 |
| Enzyme 14 Protein Sequence |
>EF0040 (Choloylglycine hydrolase) (Choloylglycine hydrolase family protein)
MCTAITYVSKDHYFGRNFDYEISYNEVVTITPRNYKFSFREVGNLDHHFAIIGIAAGIAD
YPLYYDAINEKGLGMAGLNFSGYADYKKIEEGKENVSPFEFIPWVLGQCSTVDEAKKLLK
NLNLVNINFSDELPLSPLHWLLADKEQSIVVESTKEGLRVFDNPVGVLTNNPTFDYQLFN
LNNYRVLSTRTPKNNFSDQIELDIYSRGMGGIGLPGDLSSVSRFVKATFTKLNSVSRSSE
YESISQFFHILSSVEQQKGLCDVGDEKYEYTIYSSCCNLEKGIYYYRTYDNSQITAVDMN
KENLEKDSLIVYPMVETQQINYAN
|
| Enzyme 14 Number of Residues |
324 |
| Enzyme 14 Molecular Weight |
36933 |
| Enzyme 14 Theoretical pI |
4.65 |
| Enzyme 14 GO Classification |
Not Available |
| Enzyme 14 General Function |
Cell wall/membrane/envelope biogenesis |
| Enzyme 14 Specific Function |
Not Available |
| Enzyme 14 Pathways |
Not Available |
| Enzyme 14 Reactions |
Not Available |
| Enzyme 14 Pfam Domain Function |
|
| Enzyme 14 Signals |
|
| Enzyme 14 Transmembrane Regions |
|
| Enzyme 14 Essentiality |
Not Available |
| Enzyme 14 GenBank ID Protein |
Not Available |
| Enzyme 14 UniProtKB/Swiss-Prot ID |
Q8KUA7 |
| Enzyme 14 UniProtKB/Swiss-Prot Entry Name |
Q8KUA7_ENTFA |
| Enzyme 14 PDB ID |
Not Available |
| Enzyme 14 Cellular Location |
Not Available |
| Enzyme 14 Gene Sequence |
Not Available |
| Enzyme 14 GenBank Gene ID |
AY032999 |
| Enzyme 14 GeneCard ID |
Not Available |
| Enzyme 14 GenAtlas ID |
Not Available |
| Enzyme 14 HGNC ID |
Not Available |
| Enzyme 14 Chromosome Location |
Not Available |
| Enzyme 14 Locus |
Not Available |
| Enzyme 14 SNPs |
SNPJam Report |
| Enzyme 14 General References |
- Shankar N, Baghdayan AS, Gilmore MS: Modulation of virulence within a pathogenicity island in vancomycin-resistant Enterococcus faecalis. Nature. 2002 Jun 13;417(6890):746-50. [PubMed ]
- Paulsen IT, Banerjei L, Myers GS, Nelson KE, Seshadri R, Read TD, Fouts DE, Eisen JA, Gill SR, Heidelberg JF, Tettelin H, Dodson RJ, Umayam L, Brinkac L, Beanan M, Daugherty S, DeBoy RT, Durkin S, Kolonay J, Madupu R, Nelson W, Vamathevan J, Tran B, Upton J, Hansen T, Shetty J, Khouri H, Utterback T, Radune D, Ketchum KA, Dougherty BA, Fraser CM: Role of mobile DNA in the evolution of vancomycin-resistant Enterococcus faecalis. Science. 2003 Mar 28;299(5615):2071-4. [PubMed ]
|
| Enzyme 14 Metabolite References |
Not Available |
|
Enzyme 15
[top]
|
| Enzyme 15 ID |
16696 |
| Enzyme 15 Name |
Conjugated bile acid hydrolase |
| Enzyme 15 Synonyms |
Not Available |
| Enzyme 15 Gene Name |
cbaH |
| Enzyme 15 Protein Sequence |
>Conjugated bile acid hydrolase
MCTGVRFSDDEGNTYFGRNLDWSFSYGETILVTPRGYHYDTVFGAGGKAKPNAVIGVGVV
MADRPMYFDCANEHGLAIAGLNFPGYASFVHEPVEGTENVATFEFPLWVARNFDSVDEVE
EALRNVTLVSQIVPGQQESLLHWFIGDGKRSIVVEQMADGMHVHHDDVDVLTNQPTFDFH
MENLRNYMCVSNEMAEPTSWGKASLTAWGAGVGMHGIPGDVSSPSRFVRVAYTNAHYPQQ
NDEAANVSRLFHTLGSVQMVDGMAKMGDGQFERTLFTSGYSSKTNTYYMNTYDDPAIRSY
AMADYDMDSSELISVAR
|
| Enzyme 15 Number of Residues |
317 |
| Enzyme 15 Molecular Weight |
35125 |
| Enzyme 15 Theoretical pI |
4.49 |
| Enzyme 15 GO Classification |
Not Available |
| Enzyme 15 General Function |
Cell wall/membrane/envelope biogenesis |
| Enzyme 15 Specific Function |
Not Available |
| Enzyme 15 Pathways |
Not Available |
| Enzyme 15 Reactions |
Not Available |
| Enzyme 15 Pfam Domain Function |
|
| Enzyme 15 Signals |
|
| Enzyme 15 Transmembrane Regions |
|
| Enzyme 15 Essentiality |
Not Available |
| Enzyme 15 GenBank ID Protein |
Not Available |
| Enzyme 15 UniProtKB/Swiss-Prot ID |
B3DS63 |
| Enzyme 15 UniProtKB/Swiss-Prot Entry Name |
B3DS63_BIFLD |
| Enzyme 15 PDB ID |
Not Available |
| Enzyme 15 Cellular Location |
Not Available |
| Enzyme 15 Gene Sequence |
Not Available |
| Enzyme 15 GenBank Gene ID |
CP000605 |
| Enzyme 15 GeneCard ID |
Not Available |
| Enzyme 15 GenAtlas ID |
Not Available |
| Enzyme 15 HGNC ID |
Not Available |
| Enzyme 15 Chromosome Location |
Not Available |
| Enzyme 15 Locus |
Not Available |
| Enzyme 15 SNPs |
SNPJam Report |
| Enzyme 15 General References |
Not Available |
| Enzyme 15 Metabolite References |
Not Available |
