Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01026
Secondary Accession Numbers
  • 6314
Name Pantothenate kinase 1
Synonyms
  1. Pantothenic acid kinase 1
  2. hPanK
  3. hPanK1
Gene Name PANK1
Protein Type Enzyme
Biological Properties
General Function Involved in pantothenate kinase activity
Specific Function Plays a role in the physiological regulation of the intracellular CoA concentration (By similarity).
Pathways
  • coenzyme A biosynthesis
  • Fanconi-bickel syndrome
  • Fructose-1,6-diphosphatase deficiency
  • Gluconeogenesis
  • Glycogen Storage Disease Type 1A (GSD1A) or Von Gierke Disease
  • Glycogenosis, Type IA. Von gierke disease
  • Glycogenosis, Type IB
  • Glycogenosis, Type IC
  • Glycogenosis, Type VII. Tarui disease
  • Glycolysis
  • Pantothenate and CoA biosynthesis
  • Pantothenate and CoA Biosynthesis
  • Phosphoenolpyruvate carboxykinase deficiency 1 (PEPCK1)
  • Triosephosphate isomerase
Reactions
Adenosine triphosphate + Pantothenic acid → ADP + D-4'-Phosphopantothenate details
Adenosine triphosphate + Pantetheine → ADP + Pantetheine 4'-phosphate details
Adenosine triphosphate + D-Pantothenoyl-L-cysteine → ADP + 4'-Phosphopantothenoylcysteine details
GO Classification
Biological Process
pantothenate metabolic process
coenzyme A biosynthetic process
coenzyme biosynthetic process
Cellular Component
cytosol
cell periphery
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
pantothenate kinase activity
Molecular Function
ATP binding
pantothenate kinase activity
Process
metabolic process
coenzyme biosynthetic process
cellular metabolic process
coenzyme a biosynthetic process
cofactor metabolic process
coenzyme metabolic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 10
Locus 10q23.31
SNPs PANK1
Gene Sequence
>1797 bp
ATGTTGAAACTCGTCGGTGGCGGTGGCGGGCAGGACTGGGCATGCTCAGTGGCGGGGACC
AGTCTGGGAGGCGAGGAAGCCGCGTTTGAAGTCGCGCGGCCTGGGGATCAGGGGAAGGCG
GGCGGCGGGAGCCCCGGCTGGGGGTGCGCGGGGATCCCCGATTCCGCGCCCGGGGCTGGC
GTGCTCCAGGCCGGCGCCGTGGGGCCGGCGCGCGGGGGGCAGGGCGCAGAGGAGGTGGGG
GAGTCGGCAGGAGGAGGGGAGGAGCGCCGGGTTCGCCATCCCCAGGCGCCGGCTCTGCGG
CTGCTGAATCGGAAGCCGCAGGGAGGATCCGGGGAAATAAAGACGCCGGAGAATGACCTC
CAGCGAGGCCGCCTGAGCCGGGGCCCGCGCACAGCCCCGCCAGCCCCCGGCATGGGCGAC
CGCAGCGGGCAGCAGGAGCGCTCGGTCCCGCACTCTCCAGGGGCCCCCGTGGGCACCAGC
GCCGCCGCTGTGAACGGGCTGCTGCACAACGGCTTCCATCCGCCGCCAGTCCAGCCGCCG
CACGTCTGCAGCCGGGGTCCAGTGGGCGGCAGCGACGCGGCGCCCCAGCGCCTCCCGCTC
CTGCCGGAGCTGCAGCCGCAGCCACTGCTCCCTCAGCATGACTCCCCGGCCAAGAAATGC
CGGCTGCGGAGGAGGATGGACTCGGGGAGAAAGAACAGGCCGCCATTCCCATGGTTTGGC
ATGGACATCGGTGGAACGCTGGTTAAATTGGTGTATTTCGAGCCGAAGGATATTACAGCC
GAAGAGGAGCAAGAGGAAGTGGAGAACCTGAAGAGCATCCGGAAGTATTTGACTTCTAAT
ACTGCTTATGGGAAAACTGGGATCCGAGACGTCCACCTGGAACTGAAAAACCTGACCATG
TGTGGACGCAAAGGGAACCTGCACTTCATCCGCTTTCCCAGCTGTGCTATGCACAGGTTC
ATTCAGATGGGCAGCGAGAAGAACTTCTCTAGCCTTCACACCACCCTCTGTGCCACAGGA
GGCGGGGCTTTCAAATTCGAAGAGGACTTCAGAATGATTGCTGACCTGCAGCTGCATAAA
CTGGATGAACTGGACTGTCTGATTCAGGGCCTGCTTTATGTCGACTCTGTTGGCTTCAAC
GGCAAGCCAGAATGTTACTATTTTGAAAATCCCACAAATCCTGAATTGTGTCAAAAAAAG
CCGTACTGCCTTGATAACCCATACCCTATGTTGCTGGTTAACATGGGCTCAGGTGTCAGC
ATTCTAGCCGTGTACTCCAAGGACAACTATAAAAGAGTTACAGGGACCAGTCTTGGAGGT
GGAACATTCCTAGGCCTATGTTGCTTGCTGACTGGTTGTGAGACCTTTGAAGAAGCTCTG
GAAATGGCAGCTAAAGGCGACAGCACCAATGTTGATAAACTGGTGAAGGACATTTACGGA
GGAGACTATGAACGATTTGGCCTTCAAGGATCTGCTGTAGCATCAAGCTTTGGCAACATG
ATGAGTAAAGAAAAGCGAGATTCCATCAGCAAGGAAGACCTCGCCCGGGCCACATTGGTC
ACCATCACCAACAACATTGGCTCCATTGCTCGGATGTGCGCGTTGAATGAGAACATAGAC
AGAGTTGTGTTTGTTGGAAATTTTCTCAGAATCAATATGGTCTCCATGAAGCTGCTGGCA
TATGCCATGGATTTTTGGTCCAAAGGACAACTGAAAGCTCTGTTTTTGGAACATGAGGGT
TATTTTGGAGCCGTTGGGGCACTGTTGGAACTGTTCAAAATGACTGATGACAAGTAG
Protein Properties
Number of Residues 598
Molecular Weight 35578.965
Theoretical pI 7.636
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Pantothenate kinase 1
MLKLVGGGGGQDWACSVAGTSLGGEEAAFEVARPGDQGKAGGGSPGWGCAGIPDSAPGAG
VLQAGAVGPARGGQGAEEVGESAGGGEERRVRHPQAPALRLLNRKPQGGSGEIKTPENDL
QRGRLSRGPRTAPPAPGMGDRSGQQERSVPHSPGAPVGTSAAAVNGLLHNGFHPPPVQPP
HVCSRGPVGGSDAAPQRLPLLPELQPQPLLPQHDSPAKKCRLRRRMDSGRKNRPPFPWFG
MDIGGTLVKLVYFEPKDITAEEEQEEVENLKSIRKYLTSNTAYGKTGIRDVHLELKNLTM
CGRKGNLHFIRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDFRMIADLQLHK
LDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVS
ILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYG
GDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENID
RVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALLELFKMTDDK
GenBank ID Protein 23510400
UniProtKB/Swiss-Prot ID Q8TE04
UniProtKB/Swiss-Prot Entry Name PANK1_HUMAN
PDB IDs
GenBank Gene ID NM_148977.1
GeneCard ID PANK1
GenAtlas ID PANK1
HGNC ID HGNC:8598
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  3. Zhou B, Westaway SK, Levinson B, Johnson MA, Gitschier J, Hayflick SJ: A novel pantothenate kinase gene (PANK2) is defective in Hallervorden-Spatz syndrome. Nat Genet. 2001 Aug;28(4):345-9. [PubMed:11479594 ]
  4. Ni X, Ma Y, Cheng H, Jiang M, Ying K, Xie Y, Mao Y: Cloning and characterization of a novel human pantothenate kinase gene. Int J Biochem Cell Biol. 2002 Feb;34(2):109-15. [PubMed:11809413 ]
  5. Ramaswamy G, Karim MA, Murti KG, Jackowski S: PPARalpha controls the intracellular coenzyme A concentration via regulation of PANK1alpha gene expression. J Lipid Res. 2004 Jan;45(1):17-31. Epub 2003 Oct 1. [PubMed:14523052 ]